(data stored in SCRATCH zone)

EMBL: CR848038.PE254

CR848038.PE254       Location/Qualifiers
FT   CDS             280899..281663
FT                   /transl_table=11
FT                   /locus_tag="CAB256"
FT                   /product="membrane transport protein, solute binding
FT                   component"
FT                   /note="Similar to many aminoacid transprot proteins
FT                   including: Escherichia coli arginine-binding periplasmic
FT                   protein 2 precursor ArtJ or b0860 SWALL:ARTJ_ECOLI
FT                   (SWALL:P30860) (243 aa) fasta scores: E(): 1.8e-15, 30.63%
FT                   id in 222 aa and to Chlamydia pneumoniae arginine
FT                   periplasmic binding protein ArtJ or cpn0482 SWALL:Q9Z869
FT                   (EMBL:AE001633) (259 aa) fasta scores: E(): 1.2e-62, 62.05%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB256"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63712"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6L0"
FT                   /protein_id="CAH63712.1"
FT                   /translation="MKQWISCLRILFFGCCLLLVGCNSSVKRDKIWLVGTNATYPPFEF
FT                   IDKHGNTIGFDIDLAEAISQRLGKELKVVEFSFDALILNLKKHRIDAVLAGMSITPSRQ
FT                   KEIAMLPYHGEGIHELTIVSRQPISKDDVLPLSKYSSVAVQTGTFQEDYLLSLPGVCVR
FT                   SFDSTLEVLMEVGCKKSPIAVLEPSVAHVVLKEFPDVYTTTVDLPEDQWVLGCGLGIAK
FT                   DRPEHVKEVQNVLEELRADGTLLKLEKKWGLH"
     MKQWISCLRI LFFGCCLLLV GCNSSVKRDK IWLVGTNATY PPFEFIDKHG NTIGFDIDLA        60
     EAISQRLGKE LKVVEFSFDA LILNLKKHRI DAVLAGMSIT PSRQKEIAML PYHGEGIHEL       120
     TIVSRQPISK DDVLPLSKYS SVAVQTGTFQ EDYLLSLPGV CVRSFDSTLE VLMEVGCKKS       180
     PIAVLEPSVA HVVLKEFPDV YTTTVDLPED QWVLGCGLGI AKDRPEHVKE VQNVLEELRA       240
     DGTLLKLEKK WGLH                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page