(data stored in SCRATCH zone)

EMBL: CR848038.PE287

CR848038.PE287       Location/Qualifiers
FT   CDS             complement(343521..343745)
FT                   /transl_table=11
FT                   /locus_tag="CAB295"
FT                   /product="hypothetical protein"
FT                   /note="doubtful CDS with no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:CAB295"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6I0"
FT                   /protein_id="CAH63745.1"
FT                   /translation="MITTEFLRKIPYFPCSPVPVHTVLIKKNSEQRPIEIRLIVFVSVP
FT                   TEGVKNMHPQDEDSAAQRIWVPNTANVSG"
     MITTEFLRKI PYFPCSPVPV HTVLIKKNSE QRPIEIRLIV FVSVPTEGVK NMHPQDEDSA        60
     AQRIWVPNTA NVSG                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page