(data stored in SCRATCH zone)

EMBL: CR848038.PE291

CR848038.PE291       Location/Qualifiers
FT   CDS             348439..349524
FT                   /transl_table=11
FT                   /locus_tag="CAB299"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydia pneumoniae protein precursor
FT                   cpn1058 or cp0792 or cpj1058 SWALL:YA58_CHLPN
FT                   (SWALL:Q9Z6K1) (363 aa) fasta scores: E(): 2.7e-91, 64.24%
FT                   id in 358 aa, and to Clostridium perfringens hypothetical
FT                   protein Cpe0268 cpe0268 SWALL:Q8XNR4 (EMBL:AP003186) (248
FT                   aa) fasta scores: E(): 8.5, 19.13% id in 230 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB299"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63749"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6H6"
FT                   /protein_id="CAH63749.1"
FT                   /translation="MKNKTHSVFSLVGLVCLPGCLLGYEGSLPTNQREYPYHNEKILEE
FT                   PAGIAIHDRVLFKIDDDTVVTTLDVIQKLNLLFASSYPQLLESYPARSQYYTAMWPVVL
FT                   ESVIDEFLMVADAKAKKIQVDPTTVNQEIEAMFGRDLSFFYVHFDMTPEDIFKVVHRTL
FT                   IAQRVMGMMVRSKVMLKVTPGKIREHYNQLAEEAAKTTLWKYRVVTIKAATESLSSQIA
FT                   DRICARLNETQSWNKERLSALALSQGGQFVCSEEFIRNDKELSDAHKMELSSVNYPLAI
FT                   CSQPKAHKSGHKLYVLLEKSTLPMQPLEEIETQIKQTLFMHYAETIESQYKKKLRARYG
FT                   FDSSMIAKLLSEEAPPLFSLL"
     MKNKTHSVFS LVGLVCLPGC LLGYEGSLPT NQREYPYHNE KILEEPAGIA IHDRVLFKID        60
     DDTVVTTLDV IQKLNLLFAS SYPQLLESYP ARSQYYTAMW PVVLESVIDE FLMVADAKAK       120
     KIQVDPTTVN QEIEAMFGRD LSFFYVHFDM TPEDIFKVVH RTLIAQRVMG MMVRSKVMLK       180
     VTPGKIREHY NQLAEEAAKT TLWKYRVVTI KAATESLSSQ IADRICARLN ETQSWNKERL       240
     SALALSQGGQ FVCSEEFIRN DKELSDAHKM ELSSVNYPLA ICSQPKAHKS GHKLYVLLEK       300
     STLPMQPLEE IETQIKQTLF MHYAETIESQ YKKKLRARYG FDSSMIAKLL SEEAPPLFSL       360
     L                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page