(data stored in SCRATCH zone)

EMBL: CR848038.PE3

CR848038.PE3         Location/Qualifiers
FT   CDS             complement(2600..3034)
FT                   /transl_table=11
FT                   /locus_tag="CAB003"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia muridarum hypothetical protein
FT                   Tc0003 SWALL:Y003_CHLMU (SWALL:Q9PLU2) (143 aa) fasta
FT                   scores: E(): 6.7e-35, 74.15% id in 147 aa. Only significant
FT                   database matches are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L7A7"
FT                   /protein_id="CAH63461.1"
FT                   /translation="MNSNSAQKIIDSIKQILTLYNIDFDPSFGSALSSDSEVDYEYLLE
FT                   KTQEKIQELDKRSQEILQQTGMTREQMEVFANNPDNFSPEEWLALENIRSSCNEYKKET
FT                   EALISEVTKELGGETPQPNSSNKTKTTSSKKNKKKNWIPL"
     MNSNSAQKII DSIKQILTLY NIDFDPSFGS ALSSDSEVDY EYLLEKTQEK IQELDKRSQE        60
     ILQQTGMTRE QMEVFANNPD NFSPEEWLAL ENIRSSCNEY KKETEALISE VTKELGGETP       120
     QPNSSNKTKT TSSKKNKKKN WIPL                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page