(data stored in SCRATCH zone)

EMBL: CR848038.PE30

CR848038.PE30        Location/Qualifiers
FT   CDS             39486..39887
FT                   /transl_table=11
FT                   /locus_tag="CAB030"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae protein cpn0713 or
FT                   cp0033 or cpj0713 SWALL:Y713_CHLPN (SWALL:Q9Z7J2) (130 aa)
FT                   fasta scores: E(): 3.7e-37, 75.78% id in 128 aa. Only
FT                   significant full-length database matches are to
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63488"
FT                   /db_xref="GOA:Q5L780"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L780"
FT                   /protein_id="CAH63488.1"
FT                   /translation="MEKLIKNFATYIGITSTLEFDADGAYVLPISDLVKIRVLQNADNE
FT                   IVLNVFLGELPPSSDTNKAYLQMMVANLFGRETGGSALGLDSEGHIVMTRRIPEEVSYE
FT                   DFARYVESFMNFSETWLEDLGLNKAQQGQ"
     MEKLIKNFAT YIGITSTLEF DADGAYVLPI SDLVKIRVLQ NADNEIVLNV FLGELPPSSD        60
     TNKAYLQMMV ANLFGRETGG SALGLDSEGH IVMTRRIPEE VSYEDFARYV ESFMNFSETW       120
     LEDLGLNKAQ QGQ                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page