(data stored in SCRATCH zone)

EMBL: CR848038.PE304

CR848038.PE304       Location/Qualifiers
FT   CDS             complement(363366..364304)
FT                   /transl_table=11
FT                   /locus_tag="CAB312"
FT                   /product="putative integrase/recombinase"
FT                   /note="Similar to many integrase/recombinases including:
FT                   Escherichia coli, and Escherichia coli O6
FT                   integrase/recombinase XerD SWALL:XERD_ECOLI (SWALL:P21891)
FT                   (298 aa) fasta scores: E(): 1.2e-28, 33.22% id in 307 aa
FT                   and Pirellula sp integrase/recombinase SWALL:CAD74556
FT                   (EMBL:BX294143) (300 aa) fasta scores: E(): 5.1e-35, 36.7%
FT                   id in 316 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB312"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63762"
FT                   /db_xref="GOA:Q5L6G3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6G3"
FT                   /protein_id="CAH63762.1"
FT                   /translation="MVSAFYAFLDYLKNIKTASPHTLRNYCIDLNSFKTFLEKHGELTP
FT                   SPPICLLTKERQEAELPFSLLTKDTVRLYILKLMQENKAKRTIKRRLSAIKSFSQYCVK
FT                   QRILPDDPTETIQGPRLPKELPSPITYEQVEILMATPDLSKYTGLRDRCLLELFYSSGL
FT                   RISEIVAINHWDIDFTSHLIRIRGKGKKERLVPITPHAAQWLQHYLTHPARTSIEKDAQ
FT                   AIFLNRFGKRLTTRSIDRKFQKYLRQSGLSGHITPHTIRHTIATHWLENGMDLKTIQAL
FT                   LGHSSLETTTIYTHVSMKLKKQTHNESHPHS"
     MVSAFYAFLD YLKNIKTASP HTLRNYCIDL NSFKTFLEKH GELTPSPPIC LLTKERQEAE        60
     LPFSLLTKDT VRLYILKLMQ ENKAKRTIKR RLSAIKSFSQ YCVKQRILPD DPTETIQGPR       120
     LPKELPSPIT YEQVEILMAT PDLSKYTGLR DRCLLELFYS SGLRISEIVA INHWDIDFTS       180
     HLIRIRGKGK KERLVPITPH AAQWLQHYLT HPARTSIEKD AQAIFLNRFG KRLTTRSIDR       240
     KFQKYLRQSG LSGHITPHTI RHTIATHWLE NGMDLKTIQA LLGHSSLETT TIYTHVSMKL       300
     KKQTHNESHP HS                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page