(data stored in SCRATCH zone)

EMBL: CR848038.PE322

CR848038.PE322       Location/Qualifiers
FT   CDS             complement(384587..384988)
FT                   /transl_table=11
FT                   /locus_tag="CAB331"
FT                   /product="putative inner membrane protein"
FT                   /note="Note weakly similar to CAB330"
FT                   /db_xref="EnsemblGenomes-Gn:CAB331"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63780"
FT                   /db_xref="GOA:Q5L6E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6E6"
FT                   /protein_id="CAH63780.1"
FT                   /translation="MMRLTSSVILPSHIHTETHNTYISVPKAQITVCNTAYFPEMSRRV
FT                   LVLPILGLAWSIVVIYRRFTVMRTAYAHLHYTPNKHCEDKLCSRLHPQYYKSLIIFGIL
FT                   GGIGVLIPLLILGITIYLIKKMLYFYVTS"
     MMRLTSSVIL PSHIHTETHN TYISVPKAQI TVCNTAYFPE MSRRVLVLPI LGLAWSIVVI        60
     YRRFTVMRTA YAHLHYTPNK HCEDKLCSRL HPQYYKSLII FGILGGIGVL IPLLILGITI       120
     YLIKKMLYFY VTS                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page