(data stored in SCRATCH zone)

EMBL: CR848038.PE332

CR848038.PE332       Location/Qualifiers
FT   CDS             393043..393723
FT                   /transl_table=11
FT                   /locus_tag="CAB340"
FT                   /product="PTS system, IIa component"
FT                   /note="Similar to Chlamydia pneumoniae pts IIa protein with
FT                   hth DNA-binding domain ptsn_2 or cp0714 SWALL:Q9JS03
FT                   (EMBL:AE002230) (225 aa) fasta scores: E(): 1e-66, 75.77%
FT                   id in 227 aa, and to Escherichia coli, and Shigella
FT                   flexneri nitrogen regulatory IIa protein PtsN or rpop or
FT                   b3204 or sf3244 or s3462 SWALL:PTSN_ECOLI (SWALL:P31222)
FT                   (163 aa) fasta scores: E(): 2.5e-06, 34.92% id in 126 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB340"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63790"
FT                   /db_xref="GOA:Q5L6D6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6D6"
FT                   /protein_id="CAH63790.1"
FT                   /translation="MDLKLEELASLLDISENTVRRWLDEGAIPSYRMNNEHRFNREEIE
FT                   DWILNNQALLGLEKEEKTDKDFRDLSLKYSLYKAIYRGGVIRNVSVKNKAEALQYASSY
FT                   IAEKFNLDASVLFEMLTYRESLMSTGIGEGIALPHAKDFLINAYYDVVVPMFLTHSIDF
FT                   GALDGKPVCVLFFLFASQDKSHLNLINKIVHLGMSLEARSFLTNYPEKDQLLAYIKNWE
FT                   SQIH"
     MDLKLEELAS LLDISENTVR RWLDEGAIPS YRMNNEHRFN REEIEDWILN NQALLGLEKE        60
     EKTDKDFRDL SLKYSLYKAI YRGGVIRNVS VKNKAEALQY ASSYIAEKFN LDASVLFEML       120
     TYRESLMSTG IGEGIALPHA KDFLINAYYD VVVPMFLTHS IDFGALDGKP VCVLFFLFAS       180
     QDKSHLNLIN KIVHLGMSLE ARSFLTNYPE KDQLLAYIKN WESQIH                      226
//

If you have problems or comments...

PBIL Back to PBIL home page