(data stored in SCRATCH zone)

EMBL: CR848038.PE340

CR848038.PE340       Location/Qualifiers
FT   CDS             402923..404353
FT                   /transl_table=11
FT                   /locus_tag="CAB348"
FT                   /product="exported protein"
FT                   /note="Similar to Chlamydia pneumoniae phospholipase D
FT                   superfamily cpn0435 or cpj0435 or cp0318 SWALL:Q9Z8A8
FT                   (EMBL:AE001626) (476 aa) fasta scores: E(): 5.1e-104,
FT                   51.68% id in 476 aa> Also similar in the C-terminus to
FT                   several others e.g. Clostridium perfringens cardiolipin
FT                   synthetase Cls or ClsD or cpe1430 SWALL:CLS_CLOPE
FT                   (SWALL:Q9ZNC6) (476 aa) fasta scores: E(): 0.0027, 26.84%
FT                   id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB348"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63798"
FT                   /db_xref="GOA:Q5L6C8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6C8"
FT                   /protein_id="CAH63798.1"
FT                   /translation="MFMNKTRWSLVIAFFFVFIAKDAAAFMVHFPESKESVGVVIHDNS
FT                   VEVYESVLSAIDVANHYIELSPCMAGGNLLKEIVEHIDARMDLIPGLRAYLLIQPTFID
FT                   SEDKIVLEGIKSRWPNRFFYLFTGCPPGPSILSPNVIESHVKISIIDGKYIFMGGTNFE
FT                   DFMCTRGDTIPEPVESPRLVIGGIHRPLAFRDQDITVSSARLGTELRKEFHAHYALWRT
FT                   YAERPWFNKNLDDFRALPFPQLSVEEAQATYCPKIEENSDLVSTDLKNIRVIFSGPDES
FT                   KNAITQGYVDLIDNAKKSIKIANMYFIPNNDILESLRSASFSRKVRTEIITNGSNENSP
FT                   PLTEVYAWGNRMNYFFLSYGERPALWKKFIFSKKQPNSSLRVNEYYVRDTQLHKKCMIV
FT                   DDRVFVIGSYNFGKKSDLFDYEGIILIDSPEVAAKANVVFKKDLSLSKPIENSEIFGWY
FT                   FDPMYNLLGHLQINFMPA"
     MFMNKTRWSL VIAFFFVFIA KDAAAFMVHF PESKESVGVV IHDNSVEVYE SVLSAIDVAN        60
     HYIELSPCMA GGNLLKEIVE HIDARMDLIP GLRAYLLIQP TFIDSEDKIV LEGIKSRWPN       120
     RFFYLFTGCP PGPSILSPNV IESHVKISII DGKYIFMGGT NFEDFMCTRG DTIPEPVESP       180
     RLVIGGIHRP LAFRDQDITV SSARLGTELR KEFHAHYALW RTYAERPWFN KNLDDFRALP       240
     FPQLSVEEAQ ATYCPKIEEN SDLVSTDLKN IRVIFSGPDE SKNAITQGYV DLIDNAKKSI       300
     KIANMYFIPN NDILESLRSA SFSRKVRTEI ITNGSNENSP PLTEVYAWGN RMNYFFLSYG       360
     ERPALWKKFI FSKKQPNSSL RVNEYYVRDT QLHKKCMIVD DRVFVIGSYN FGKKSDLFDY       420
     EGIILIDSPE VAAKANVVFK KDLSLSKPIE NSEIFGWYFD PMYNLLGHLQ INFMPA           476
//

If you have problems or comments...

PBIL Back to PBIL home page