(data stored in SCRATCH zone)

EMBL: CR848038.PE341

CR848038.PE341       Location/Qualifiers
FT   CDS             404474..406546
FT                   /transl_table=11
FT                   /locus_tag="CAB349"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar to Chlamydia muridarum hypothetical protein
FT                   Tc0556 tc0556 SWALL:Q9PKB1 (EMBL:AE002323) (690 aa) fasta
FT                   scores: E(): 1.5e-154, 56.24% id in 681 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB349"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63799"
FT                   /db_xref="GOA:Q5L6C7"
FT                   /db_xref="InterPro:IPR017513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6C7"
FT                   /protein_id="CAH63799.1"
FT                   /translation="MALLAFFYKHQKKFMGFVIVGVCVSGIGIGWGRYPGESSRGSKKI
FT                   VFSVPGKKYSEREFLAFKRFFTNEAYPFTGNPQAWNFLNEGLLTERFLTNKLGEKLFLK
FT                   VYSQDYPAFKKEKNYQSYRRFDSLFISSEEVWKSSAPRLYQALVALQEIHDPVSPEGFV
FT                   ARVQLFLEEKKFPHYILKQMLEYRRQMFNLPQDPVLAQGKDLHLFGYRNIADWFGDAYV
FT                   SAAVEALLRFVNEQKKNVAMPSLKEAQQDFQDKAKQAFTKLSKHAGLTLSFDQFVASYF
FT                   DFMGVSESEFFNIYREILLCKRAFLQLEGSVTFDYRPLQEFFSMGKDSTSVEMVKLPRE
FT                   YQFKNKEDLEAFEVYISLVGEPIKDCLSVPRCTLPIKTIKAKEPRLVGRRFLVSYKSVK
FT                   LQDLETKVPMVEVHQWQQNPENFQVLLQQFPKIETCNSSKDFQTLKPSLVEKIYSFTRK
FT                   EILRSSPKRILEGLAQCEQKSHEVFLSARKDSVLEGILDGNELAKLLLDNEVLEAYSQD
FT                   GEHYYTFVVDTCFEGEEVIPYREVLRKGLAKTLVSSHKNIAHIDRVVAALKSRYQEEEN
FT                   SNLWQKRLWLLVEEHREGTYQPGALSWNLEKSIKVFTRGDQNIPQPYPVLASMEEGALS
FT                   GVEFNPDEGPFFYKCLSHQTCMEPTSVEKLFLTKNHLNEEILGSYIEHFIDEGVR"
     MALLAFFYKH QKKFMGFVIV GVCVSGIGIG WGRYPGESSR GSKKIVFSVP GKKYSEREFL        60
     AFKRFFTNEA YPFTGNPQAW NFLNEGLLTE RFLTNKLGEK LFLKVYSQDY PAFKKEKNYQ       120
     SYRRFDSLFI SSEEVWKSSA PRLYQALVAL QEIHDPVSPE GFVARVQLFL EEKKFPHYIL       180
     KQMLEYRRQM FNLPQDPVLA QGKDLHLFGY RNIADWFGDA YVSAAVEALL RFVNEQKKNV       240
     AMPSLKEAQQ DFQDKAKQAF TKLSKHAGLT LSFDQFVASY FDFMGVSESE FFNIYREILL       300
     CKRAFLQLEG SVTFDYRPLQ EFFSMGKDST SVEMVKLPRE YQFKNKEDLE AFEVYISLVG       360
     EPIKDCLSVP RCTLPIKTIK AKEPRLVGRR FLVSYKSVKL QDLETKVPMV EVHQWQQNPE       420
     NFQVLLQQFP KIETCNSSKD FQTLKPSLVE KIYSFTRKEI LRSSPKRILE GLAQCEQKSH       480
     EVFLSARKDS VLEGILDGNE LAKLLLDNEV LEAYSQDGEH YYTFVVDTCF EGEEVIPYRE       540
     VLRKGLAKTL VSSHKNIAHI DRVVAALKSR YQEEENSNLW QKRLWLLVEE HREGTYQPGA       600
     LSWNLEKSIK VFTRGDQNIP QPYPVLASME EGALSGVEFN PDEGPFFYKC LSHQTCMEPT       660
     SVEKLFLTKN HLNEEILGSY IEHFIDEGVR                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page