(data stored in SCRATCH zone)

EMBL: CR848038.PE343

CR848038.PE343       Location/Qualifiers
FT   CDS             407009..407323
FT                   /transl_table=11
FT                   /locus_tag="CAB351"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00360 SWALL:Q823P7 (EMBL:AE016995) (97 aa) fasta scores:
FT                   E(): 1.1e-22, 67.74% id in 93 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB351"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63801"
FT                   /db_xref="GOA:Q5L6C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6C5"
FT                   /protein_id="CAH63801.1"
FT                   /translation="MSSFMVNVSNPIEMANTQLQLSKQLKVLTIATVILILAVIGFACY
FT                   GLFGTPCIAIQLMIWIMCTSMTIVALICSCVKYHLIRRYENTYLVAGSLLDKGIKTYDH
FT                   "
     MSSFMVNVSN PIEMANTQLQ LSKQLKVLTI ATVILILAVI GFACYGLFGT PCIAIQLMIW        60
     IMCTSMTIVA LICSCVKYHL IRRYENTYLV AGSLLDKGIK TYDH                        104
//

If you have problems or comments...

PBIL Back to PBIL home page