(data stored in SCRATCH zone)

EMBL: CR848038.PE350

CR848038.PE350       Location/Qualifiers
FT   CDS             complement(412191..412784)
FT                   /transl_table=11
FT                   /locus_tag="CAB357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae ct276 hypothetical
FT                   protein cpn0425 or cpj0425 or cp0328 SWALL:Q9Z8B8
FT                   (EMBL:AE001625) (195 aa) fasta scores: E(): 1e-45, 72.22%
FT                   id in 198 aa. Only significant full-length database matches
FT                   are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB357"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63808"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6B9"
FT                   /protein_id="CAH63808.1"
FT                   /translation="MFRRTGKNPFEDVQTLYEEETPAHSTYSSYPRSERLDSPPNLFDS
FT                   PKSPETRPLSPTYPLNEEAQKWIPASAEVDSLLSFSEEPETTLGEGVTFKGELAFDRLL
FT                   RIDGTFEGILVSNGKIIIGPKGCVKADIQLQEAIIEGAVEGNITVSGKLELRGEAMVKG
FT                   DIQAGTLCVDEGVRLLGYVAIVGINTESQKEKDS"
     MFRRTGKNPF EDVQTLYEEE TPAHSTYSSY PRSERLDSPP NLFDSPKSPE TRPLSPTYPL        60
     NEEAQKWIPA SAEVDSLLSF SEEPETTLGE GVTFKGELAF DRLLRIDGTF EGILVSNGKI       120
     IIGPKGCVKA DIQLQEAIIE GAVEGNITVS GKLELRGEAM VKGDIQAGTL CVDEGVRLLG       180
     YVAIVGINTE SQKEKDS                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page