(data stored in SCRATCH zone)

EMBL: CR848038.PE359

CR848038.PE359       Location/Qualifiers
FT   CDS             420817..421536
FT                   /transl_table=11
FT                   /locus_tag="CAB364"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Weakly similar to Thermoanaerobacter tengcongensis
FT                   N-acetylmuramoyl-L-alanine amidase AmiC2 or tte2424
FT                   SWALL:Q8R7I3 (EMBL:AE013184) (219 aa) fasta scores: E():
FT                   1.9e-18, 35.74% id in 207 aa and to Bacillus subtilis
FT                   N-acetylmuramoyl-L-alanine amidase CwlB precursor
FT                   SWALL:CWLB_BACSU (SWALL:Q02114) (496 aa) fasta scores: E():
FT                   6.8e-16, 34.06% id in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB364"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63817"
FT                   /db_xref="GOA:Q5L6B1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6B1"
FT                   /protein_id="CAH63817.1"
FT                   /translation="MFNRYTLLTACVFGTALGGIAAESALPQRVRRNEVIFIDPGHGGK
FT                   DQGTASKEFHYEEKSLTLSLAFSVQSYLKRMGYKPVLTRTSDVYVDLGKRAALANQNKA
FT                   DIFVSIHCNYSSNTSAFGTEVYFYNGKNNVASRSRASEALAKDVLNAMQKNGALKIRGA
FT                   KNGNFAVIRETTMPAILIETGFLSNPRERAALSDARYRMHIAKGIAEGVHTFLTGPNFQ
FT                   KPSLASVKARKLSAKVN"
     MFNRYTLLTA CVFGTALGGI AAESALPQRV RRNEVIFIDP GHGGKDQGTA SKEFHYEEKS        60
     LTLSLAFSVQ SYLKRMGYKP VLTRTSDVYV DLGKRAALAN QNKADIFVSI HCNYSSNTSA       120
     FGTEVYFYNG KNNVASRSRA SEALAKDVLN AMQKNGALKI RGAKNGNFAV IRETTMPAIL       180
     IETGFLSNPR ERAALSDARY RMHIAKGIAE GVHTFLTGPN FQKPSLASVK ARKLSAKVN        239
//

If you have problems or comments...

PBIL Back to PBIL home page