(data stored in SCRATCH zone)

EMBL: CR848038.PE361

CR848038.PE361       Location/Qualifiers
FT   CDS             422353..423537
FT                   /transl_table=11
FT                   /locus_tag="CAB366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several proteins of undefined function
FT                   e.g. Chlamydia pneumoniae hypothetical protein Cp0339
FT                   SWALL:Q9K294 (EMBL:AE002196) (404 aa) fasta scores: E():
FT                   3.1e-101, 63.33% id in 390 aa and to Chlamydia muridarum
FT                   hypothetical protein Tc0537 tc0537 SWALL:Q9PKC8
FT                   (EMBL:AE002322) (393 aa) fasta scores: E(): 5.8e-89, 56.88%
FT                   id in 392 aa. Only significant full-length database matches
FT                   are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB366"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63819"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6A9"
FT                   /protein_id="CAH63819.1"
FT                   /translation="MVMGSQLRLQECIEVFPHSNFDLQVKQLIYACQDKKLRNFVFKFF
FT                   RYHPLLKVHDIARAVYLLIALEEGQDLGLDFLKLEQEDSGAARLFGRGGFPWKGLPYPG
FT                   EHAELGLLLLQISRFYDDSLKQAQMMGEFQQALFMHEATIFPALWSQEHARSIKEKTSL
FT                   SKSFLYQLDQQVTSEYTFTDPHLGFWMQRTRSASAFVSGSGCKSGVGAYYSGDVGVVNY
FT                   GPCYGDISDCQGFGLCGTVKEFSFAENPDTTEISFLSAGSVPCSRITGFSYLQDAYLGS
FT                   KIRHHITISERRCQIYSLIEDPCKSTFSIFCRGKSCQVVEGPRLRSSSLDSYKGPSNDV
FT                   IIHGERDSLRILSSSLYMEIFSLQEKERFWGSNFLINIPYQDAEVSVVFEKCNL"
     MVMGSQLRLQ ECIEVFPHSN FDLQVKQLIY ACQDKKLRNF VFKFFRYHPL LKVHDIARAV        60
     YLLIALEEGQ DLGLDFLKLE QEDSGAARLF GRGGFPWKGL PYPGEHAELG LLLLQISRFY       120
     DDSLKQAQMM GEFQQALFMH EATIFPALWS QEHARSIKEK TSLSKSFLYQ LDQQVTSEYT       180
     FTDPHLGFWM QRTRSASAFV SGSGCKSGVG AYYSGDVGVV NYGPCYGDIS DCQGFGLCGT       240
     VKEFSFAENP DTTEISFLSA GSVPCSRITG FSYLQDAYLG SKIRHHITIS ERRCQIYSLI       300
     EDPCKSTFSI FCRGKSCQVV EGPRLRSSSL DSYKGPSNDV IIHGERDSLR ILSSSLYMEI       360
     FSLQEKERFW GSNFLINIPY QDAEVSVVFE KCNL                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page