(data stored in SCRATCH zone)

EMBL: CR848038.PE390

CR848038.PE390       Location/Qualifiers
FT   CDS             453733..454233
FT                   /transl_table=11
FT                   /locus_tag="CAB395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several Chlamydia proteins of undefined
FT                   function including: Chlamydia pneumoniae ct043 hypothetical
FT                   protein cpn0387 or cpj0387 or cp0368 SWALL:Q9Z8F6
FT                   (EMBL:AE001623) (166 aa) fasta scores: E(): 9.3e-65, 98.79%
FT                   id in 166 aa. Only significant full-length database matches
FT                   are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB395"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63848"
FT                   /db_xref="GOA:Q5L683"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L683"
FT                   /protein_id="CAH63848.1"
FT                   /translation="MSRQNAEENLKNFAKELKLPDVAFDQNNTCILFVDGEFSLHLTYE
FT                   EHSDRLYVYAPLLDGLPDNTQRKLALYEKLLEGSMLGGQMAGGGVGVATKEQLVLMHCV
FT                   LDMKYAETNLLKAFAQLFIETVVKWRTVCADICAGREPSVDTMPQMPQSGGGMQPPPTG
FT                   IRA"
     MSRQNAEENL KNFAKELKLP DVAFDQNNTC ILFVDGEFSL HLTYEEHSDR LYVYAPLLDG        60
     LPDNTQRKLA LYEKLLEGSM LGGQMAGGGV GVATKEQLVL MHCVLDMKYA ETNLLKAFAQ       120
     LFIETVVKWR TVCADICAGR EPSVDTMPQM PQSGGGMQPP PTGIRA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page