(data stored in SCRATCH zone)

EMBL: CR848038.PE393

CR848038.PE393       Location/Qualifiers
FT   CDS             457044..457508
FT                   /transl_table=11
FT                   /locus_tag="CAB398"
FT                   /product="histone-like protein"
FT                   /note="Similar to Bordetella pertussis histone H1
FT                   SWALL:Q45370 (EMBL:L37438) (182 aa) fasta scores: E():
FT                   7e-09, 41.13% id in 141 aa and to Xanthomonas axonopodis
FT                   histone h1 xac3058 SWALL:Q8PI40 (EMBL:AE011948) (155 aa)
FT                   fasta scores: E(): 2e-08, 52.72% id in 110 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB398"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63851"
FT                   /db_xref="GOA:Q5L680"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L680"
FT                   /protein_id="CAH63851.1"
FT                   /translation="MLGVQKKRSSKKTATKAVRKPARKATAKKTATRKPAVKKAVRKTA
FT                   AKKATVRKTVSKMTVRKTVAKKATAKKTATRKPAARKTVRKTAAKTAATRKPAARKAVA
FT                   KPAMSCHKHHKHTASCQRVCASSAKRRCGSKSRVRTAHGWRQQLMKLVSR"
     MLGVQKKRSS KKTATKAVRK PARKATAKKT ATRKPAVKKA VRKTAAKKAT VRKTVSKMTV        60
     RKTVAKKATA KKTATRKPAA RKTVRKTAAK TAATRKPAAR KAVAKPAMSC HKHHKHTASC       120
     QRVCASSAKR RCGSKSRVRT AHGWRQQLMK LVSR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page