(data stored in SCRATCH zone)

EMBL: CR848038.PE40

CR848038.PE40        Location/Qualifiers
FT   CDS             47897..49405
FT                   /transl_table=11
FT                   /locus_tag="CAB040"
FT                   /product="putative serine/threonine-protein kinase"
FT                   /note="Similar to Chlamydia pneumoniae
FT                   serine/threonine-protein kinase cpn0703 or cpj0703 or
FT                   cp0043 SWALL:Q9Z7K2 (EMBL:AE001652) (502 aa) fasta scores:
FT                   E(): 3.1e-110, 56.17% id in 502 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63498"
FT                   /db_xref="GOA:Q5L770"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L770"
FT                   /protein_id="CAH63498.1"
FT                   /translation="MDCQSEILLLHQVIGAYHIKKILSKKEGSAVYQGLHSATLQSTAI
FT                   KVLEPPLVADTRRVHNFLKEARIIEQVSHPNIVKLYQYGQCRERLYIAMEYIQGVSLRH
FT                   YILTHQIPLSRAIDIILHIGRAIEYLHSRGILHRDIKPENILMNAQGEIKLIDFGLAVS
FT                   SSTEHASHPSCLGTPAYMSPEQRQGDKVSEKSEIYSLGLIAYELILGNLALGKVILSLI
FT                   PDRVSKILAKALQPSPQDRYGSMKEFMSHLHQYRYSQDLQQDYRNKDHTAQVNEQLYQQ
FT                   RFWLSPAEIVVPDFISASVYEQGYPTHPHVYYEAYMSRDTFRLWFCYSLSGNATLVLTI
FT                   IKTFVSQWGHEDSIRSTMRKIHSELLRIHAPVDTAGMSLVCVTIPKEKKELSWITCGKT
FT                   SFWLKKQGKVPQNFTTSSLGLGKISSLQIQETKVAWEIGDGAVLHTLQADDSMSSLNSP
FT                   LFTELKDRGQTAIFCPIESVQFGILENHDGNLCPSTLISLKRIW"
     MDCQSEILLL HQVIGAYHIK KILSKKEGSA VYQGLHSATL QSTAIKVLEP PLVADTRRVH        60
     NFLKEARIIE QVSHPNIVKL YQYGQCRERL YIAMEYIQGV SLRHYILTHQ IPLSRAIDII       120
     LHIGRAIEYL HSRGILHRDI KPENILMNAQ GEIKLIDFGL AVSSSTEHAS HPSCLGTPAY       180
     MSPEQRQGDK VSEKSEIYSL GLIAYELILG NLALGKVILS LIPDRVSKIL AKALQPSPQD       240
     RYGSMKEFMS HLHQYRYSQD LQQDYRNKDH TAQVNEQLYQ QRFWLSPAEI VVPDFISASV       300
     YEQGYPTHPH VYYEAYMSRD TFRLWFCYSL SGNATLVLTI IKTFVSQWGH EDSIRSTMRK       360
     IHSELLRIHA PVDTAGMSLV CVTIPKEKKE LSWITCGKTS FWLKKQGKVP QNFTTSSLGL       420
     GKISSLQIQE TKVAWEIGDG AVLHTLQADD SMSSLNSPLF TELKDRGQTA IFCPIESVQF       480
     GILENHDGNL CPSTLISLKR IW                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page