(data stored in SCRATCH zone)

EMBL: CR848038.PE405

CR848038.PE405       Location/Qualifiers
FT   CDS             complement(471289..472470)
FT                   /transl_table=11
FT                   /locus_tag="CAB410"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00424 SWALL:Q823I6 (EMBL:AE016995) (400 aa) fasta
FT                   scores: E(): 6.9e-93, 63.01% id in 392 aa and to
FT                   Thermoanaerobacter tengcongensis O-acetylhomoserine
FT                   sulfhydrylase SWALL:Q8R872 (EMBL:AE013162) (427 aa) fasta
FT                   scores: E(): 2.5, 28.19% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB410"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63863"
FT                   /db_xref="GOA:Q5L668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L668"
FT                   /protein_id="CAH63863.1"
FT                   /translation="MSHEKISSGNNPLPPQQLFDLNPKQRFPVKGYLNRVLYNPNTRET
FT                   TRKVLAIIGGLALAGGIACGITLGVLGAPGLVIATAIGITLGTILLGASLALLPSKMKK
FT                   GIRGKIESALEANKPYDFLSPGLTNSLKAHFKESSSLPKNMHAPGATDVDVFTAKNNSE
FT                   VKLVTFKTPSFLSPITVAGTGVSRVCFIPPEADLTRPETMQNSSLDLFKIEIGPRGWNT
FT                   NLAEFAQTPKTPAGWSRSSWSNLTEPATDDSPQYLISAWNPFGHYPTTANQQRAQTRHP
FT                   LYERNSLDNQKEMFVNFFKSLMASGIHSIGIYGNDLLFPKNDLNDSYIDIFAPLDGDFE
FT                   GRVATALSSALAEIAQDSGNNLTVCLYSMGGNPLHKPKPVSYDRMYMDDADDD"
     MSHEKISSGN NPLPPQQLFD LNPKQRFPVK GYLNRVLYNP NTRETTRKVL AIIGGLALAG        60
     GIACGITLGV LGAPGLVIAT AIGITLGTIL LGASLALLPS KMKKGIRGKI ESALEANKPY       120
     DFLSPGLTNS LKAHFKESSS LPKNMHAPGA TDVDVFTAKN NSEVKLVTFK TPSFLSPITV       180
     AGTGVSRVCF IPPEADLTRP ETMQNSSLDL FKIEIGPRGW NTNLAEFAQT PKTPAGWSRS       240
     SWSNLTEPAT DDSPQYLISA WNPFGHYPTT ANQQRAQTRH PLYERNSLDN QKEMFVNFFK       300
     SLMASGIHSI GIYGNDLLFP KNDLNDSYID IFAPLDGDFE GRVATALSSA LAEIAQDSGN       360
     NLTVCLYSMG GNPLHKPKPV SYDRMYMDDA DDD                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page