(data stored in SCRATCH zone)

EMBL: CR848038.PE419

CR848038.PE419       Location/Qualifiers
FT   CDS             489075..489854
FT                   /transl_table=11
FT                   /locus_tag="CAB424"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="Similar to Bacillus subtilis manganese transport
FT                   system ATP-binding protein MntB SWALL:MNTB_BACSU
FT                   (SWALL:O34338) (250 aa) fasta scores: E(): 2.9e-35, 46.12%
FT                   id in 245 aa, and to Pirellula sp manganese transport
FT                   system ATP-binding protein Rb12438 SWALL:CAD77587
FT                   (EMBL:BX294155) (280 aa) fasta scores: E(): 6.9e-37, 46.18%
FT                   id in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB424"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63877"
FT                   /db_xref="GOA:Q5L654"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L654"
FT                   /protein_id="CAH63877.1"
FT                   /translation="MSRQHEIAWSVHNLCVNYDHSDVLCHVSFLLRKGTLTAVLGPNGA
FT                   GKSTLLKSSLGLIRPSTGHTLFFGNKFKKVHQRVAYMPQRASVDWDFPMTVLDLVLMGC
FT                   YGYKGMWGRITADDRKEAYSILERVGLSDLANRQIGKLSGGQQQRAFLARALMQKADLY
FT                   LMDELFSAIDMASYQTVVDVLRELQEQGRTVVVVHHDLSHVRQLFDHIILLNKHLICSG
FT                   PVEECLTNKNIFQAYGCELELLDRTLKLSRGKQEGTY"
     MSRQHEIAWS VHNLCVNYDH SDVLCHVSFL LRKGTLTAVL GPNGAGKSTL LKSSLGLIRP        60
     STGHTLFFGN KFKKVHQRVA YMPQRASVDW DFPMTVLDLV LMGCYGYKGM WGRITADDRK       120
     EAYSILERVG LSDLANRQIG KLSGGQQQRA FLARALMQKA DLYLMDELFS AIDMASYQTV       180
     VDVLRELQEQ GRTVVVVHHD LSHVRQLFDH IILLNKHLIC SGPVEECLTN KNIFQAYGCE       240
     LELLDRTLKL SRGKQEGTY                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page