(data stored in SCRATCH zone)

EMBL: CR848038.PE420

CR848038.PE420       Location/Qualifiers
FT   CDS             489855..491204
FT                   /transl_table=11
FT                   /locus_tag="CAB425"
FT                   /product="ABC transporter, membrane permease"
FT                   /note="Similar to Bacillus subtilis manganese transport
FT                   system membrane protein MntC SWALL:MNTC_BACSU
FT                   (SWALL:O35024) (435 aa) fasta scores: E(): 2.7e-16, 23.52%
FT                   id in 391 aa and Pirellula sp manganese ABC transporter
FT                   permease protein Rb12437 SWALL:CAD77586 (EMBL:BX294155)
FT                   (444 aa) fasta scores: E(): 2.6e-13, 23.51% id in 421 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB425"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63878"
FT                   /db_xref="GOA:Q5L653"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L653"
FT                   /protein_id="CAH63878.1"
FT                   /translation="MLNCIFIDSIFLSSFLAVTLICMTTALWGTLLLIGRQPLLGESLS
FT                   HASYPGLLLGALLSCKVSFFTDSILLVVIFGCLAAISGYGIIVFLEKTLRVHKDASLCF
FT                   VLVVFFGLGVILTSYVKDCCPLLYNRINAYLYGQAATLGYVEAKLAAFVFVLSITTLWW
FT                   WYRQIIVTIFDKDYASTCGLSTRVSGSVILIFITLVIVSGVRSVGIILISSMFVAPPLA
FT                   AHQLSDRLNIIFLLSCLFGGICGALGSYISVAFTCYASGHRGVITFPTGPLVVVISGCL
FT                   TLLCLIFSPKSGWVTRYIRRKCFSFSKNQEHLLKVFWYFLEDQIPEVGARDFVCSHKYQ
FT                   EYFGPKPFPRLRIWLLECQGLVKRQDYRWSLSEKGKSRAKKLVRAHRLWECYLVRSLEF
FT                   KEEEVHGFAEEMEHVLTDELDYAITQMLDNPHYDPHNKLIPEKPQTMEEL"
     MLNCIFIDSI FLSSFLAVTL ICMTTALWGT LLLIGRQPLL GESLSHASYP GLLLGALLSC        60
     KVSFFTDSIL LVVIFGCLAA ISGYGIIVFL EKTLRVHKDA SLCFVLVVFF GLGVILTSYV       120
     KDCCPLLYNR INAYLYGQAA TLGYVEAKLA AFVFVLSITT LWWWYRQIIV TIFDKDYAST       180
     CGLSTRVSGS VILIFITLVI VSGVRSVGII LISSMFVAPP LAAHQLSDRL NIIFLLSCLF       240
     GGICGALGSY ISVAFTCYAS GHRGVITFPT GPLVVVISGC LTLLCLIFSP KSGWVTRYIR       300
     RKCFSFSKNQ EHLLKVFWYF LEDQIPEVGA RDFVCSHKYQ EYFGPKPFPR LRIWLLECQG       360
     LVKRQDYRWS LSEKGKSRAK KLVRAHRLWE CYLVRSLEFK EEEVHGFAEE MEHVLTDELD       420
     YAITQMLDNP HYDPHNKLIP EKPQTMEEL                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page