(data stored in SCRATCH zone)

EMBL: CR848038.PE439

CR848038.PE439       Location/Qualifiers
FT   CDS             complement(509971..511167)
FT                   /transl_table=11
FT                   /locus_tag="CAB444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa (Pseudomonas outer
FT                   membrane protein) PopN or pa1698 SWALL:O30531
FT                   (EMBL:AF010150) (288 aa) fasta scores: E(): 0.26, 23.82% id
FT                   in 256 aa, and to Chlamydophila caviae CopN protein copn or
FT                   cca00458 SWALL:O34020 (EMBL:U88070) (397 aa) fasta scores:
FT                   E(): 2.3e-120, 86.68% id in 398 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB444"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63897"
FT                   /db_xref="GOA:Q5L634"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L634"
FT                   /protein_id="CAH63897.1"
FT                   /translation="MAASGGAGGLGGAQAVDVAQVQAAAAKADAQEVVASQEQSDISMI
FT                   RDSQDLTNPQAATRTKKKEEKFQTLESRRKGAAQTEKKSESTGDKSDADLADKYTENNA
FT                   EISGQDLRSIRDALHDGSSEEDILDLVKSKFSDLALQGIALDYLVQTTPASKGALKDSL
FT                   IKAQQTHMQQNRQAVVGGKNILFASQEYANILQTSAPGLRALYLQVTSDFHTCEQLLQM
FT                   LQTRYNYEEMGTVSSFILKGMSADLKSEGSSVSPVKLKVMMSETRNLQAVITGYTFFQD
FT                   KFPNVMASLKADGASIPEDLKFDKVADTFFKLINDKFATASKMERGVRDLVGNDTEAIT
FT                   GILNLFFTALRGTSPRLFSSAEKRQELGTMMANALDSVNTHNEDYPKSTDFPKPYPWS"
     MAASGGAGGL GGAQAVDVAQ VQAAAAKADA QEVVASQEQS DISMIRDSQD LTNPQAATRT        60
     KKKEEKFQTL ESRRKGAAQT EKKSESTGDK SDADLADKYT ENNAEISGQD LRSIRDALHD       120
     GSSEEDILDL VKSKFSDLAL QGIALDYLVQ TTPASKGALK DSLIKAQQTH MQQNRQAVVG       180
     GKNILFASQE YANILQTSAP GLRALYLQVT SDFHTCEQLL QMLQTRYNYE EMGTVSSFIL       240
     KGMSADLKSE GSSVSPVKLK VMMSETRNLQ AVITGYTFFQ DKFPNVMASL KADGASIPED       300
     LKFDKVADTF FKLINDKFAT ASKMERGVRD LVGNDTEAIT GILNLFFTAL RGTSPRLFSS       360
     AEKRQELGTM MANALDSVNT HNEDYPKSTD FPKPYPWS                               398
//

If you have problems or comments...

PBIL Back to PBIL home page