(data stored in SCRATCH zone)

EMBL: CR848038.PE463

CR848038.PE463       Location/Qualifiers
FT   CDS             complement(539818..542190)
FT                   /transl_table=11
FT                   /locus_tag="CAB468"
FT                   /product="putative exported protein"
FT                   /note="Similar to Haemophilus influenzae protective surface
FT                   antigen d15 precursor SWALL:D153_HAEIN (SWALL:O32629) (793
FT                   aa) fasta scores: E(): 5.6e-13, 23.23% id in 835 aa and to
FT                   Xylella fastidiosa outer membrane antigen xf1046
FT                   SWALL:Q9PEI2 (EMBL:AE003941) (784 aa) fasta scores: E():
FT                   5.8e-26, 23.37% id in 830 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB468"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63921"
FT                   /db_xref="GOA:Q5L610"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L610"
FT                   /protein_id="CAH63921.1"
FT                   /translation="MFMMRNKVILRFTVLALIHAPLALAATETVKEGYTLVESITITTE
FT                   GENSLNKHPLPKLKTKSGSLFSQADFDEDLRNLSKDYDRVEPKVDFSNGKTTISLLLVA
FT                   KPCIRKISIVGNEAIPSHKILKTLQIYENDIFDREKFLKNFDELRVYYLKRGFFESQLC
FT                   YELDHNEHKGYIDVLVQIQEGPCGKIKKLEISGLNRSEKADVKELILTKQYSKTTSWFT
FT                   GNGLYHPDIVEQDSFAITNYLHNLGYADAIVTPRREVDACGNIVLYMDVEKGPLYTLGH
FT                   VHIERFDVLPRRLVEKQLSAGPNDVYCPENIWEGAQKIKNIYAKYGYINTNVDVTFSPH
FT                   ASRPVYDVTYQVSEGSPYKVGLIKITGNTHTKHDVILHESSLFPGDTFNRLKLKDTEQR
FT                   LRNTGYFQSVSVYTARSQLDPLDNAEEYRDIFIEVKETTTGNLGLFLGFSSLDNLFGGI
FT                   ELSESNFDLLGVRHFFSKGFKCLRGGGEYLFLKANFGDKVTDYTLKWTKPHFLNTPWIL
FT                   GVELDKSINRALSKDYSVETYGGNVSTTYILNQQLKYGIYYRGTQTSLYKKKKDQAGPD
FT                   LAANKGFISAAGVNLNYDSVNNPRNPTTGIRSSINFEVSGLGGTYHFTKLSVNSSIYRK
FT                   LTKKGVWKIKGEAQFLKPFGDTTIEGIPISERFFLGGETTVRGYKPFIIGPKFSPTEPQ
FT                   GGLSSLLLTEEFQYPLINQPNVSAFVFLDSGFIGLKEYTIRLKDLCGSAGFGLRFDVMN
FT                   NVPVMLGFGWPFRPTEMFESEKIDVSQRFFFALGGVF"
     MFMMRNKVIL RFTVLALIHA PLALAATETV KEGYTLVESI TITTEGENSL NKHPLPKLKT        60
     KSGSLFSQAD FDEDLRNLSK DYDRVEPKVD FSNGKTTISL LLVAKPCIRK ISIVGNEAIP       120
     SHKILKTLQI YENDIFDREK FLKNFDELRV YYLKRGFFES QLCYELDHNE HKGYIDVLVQ       180
     IQEGPCGKIK KLEISGLNRS EKADVKELIL TKQYSKTTSW FTGNGLYHPD IVEQDSFAIT       240
     NYLHNLGYAD AIVTPRREVD ACGNIVLYMD VEKGPLYTLG HVHIERFDVL PRRLVEKQLS       300
     AGPNDVYCPE NIWEGAQKIK NIYAKYGYIN TNVDVTFSPH ASRPVYDVTY QVSEGSPYKV       360
     GLIKITGNTH TKHDVILHES SLFPGDTFNR LKLKDTEQRL RNTGYFQSVS VYTARSQLDP       420
     LDNAEEYRDI FIEVKETTTG NLGLFLGFSS LDNLFGGIEL SESNFDLLGV RHFFSKGFKC       480
     LRGGGEYLFL KANFGDKVTD YTLKWTKPHF LNTPWILGVE LDKSINRALS KDYSVETYGG       540
     NVSTTYILNQ QLKYGIYYRG TQTSLYKKKK DQAGPDLAAN KGFISAAGVN LNYDSVNNPR       600
     NPTTGIRSSI NFEVSGLGGT YHFTKLSVNS SIYRKLTKKG VWKIKGEAQF LKPFGDTTIE       660
     GIPISERFFL GGETTVRGYK PFIIGPKFSP TEPQGGLSSL LLTEEFQYPL INQPNVSAFV       720
     FLDSGFIGLK EYTIRLKDLC GSAGFGLRFD VMNNVPVMLG FGWPFRPTEM FESEKIDVSQ       780
     RFFFALGGVF                                                              790
//

If you have problems or comments...

PBIL Back to PBIL home page