(data stored in SCRATCH zone)

EMBL: CR848038.PE49

CR848038.PE49        Location/Qualifiers
FT   CDS             59869..63141
FT                   /transl_table=11
FT                   /locus_tag="CAB049"
FT                   /product="putative penicillin-binding protein"
FT                   /note="Similar to Chlamydia pneumoniae penicillin-binding
FT                   protein, putative cp0052 SWALL:Q9K2E6 (EMBL:AE002167) (1090
FT                   aa) fasta scores: E(): 0, 67.76% id in 1089 aa, and to
FT                   Chlamydia pneumoniae pbp2-transglycolase/transpeptidase
FT                   pbp2 or cpn0694 SWALL:Q9Z7L0 (EMBL:AE001651) (1090 aa)
FT                   fasta scores: E(): 0, 67.76% id in 1089 aa,"
FT                   /db_xref="EnsemblGenomes-Gn:CAB049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63507"
FT                   /db_xref="GOA:Q5L761"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L761"
FT                   /protein_id="CAH63507.1"
FT                   /translation="MKSPKKRRSYLTVPEKTNRLLSGIIVALAIIAVRLWHLAVVEHDQ
FT                   KLEEAYKPQKRVIPELIERATICDRFGKVLAENKMQYDVSVAYSAIRDLPTRAWRARAD
FT                   GTRELIPVRKNYIARLAQLLAQELHLDKDTIEDNIHAKASVLGSVPYVVQANVSERTYL
FT                   GLKMMMKHWPGLHVEPSVRRYYPMGKTASDILGYVGPISAQEYKSVTHELSKLRECVRA
FT                   YEEGENPKFPEGLASIDQVRSLLNSLENNAYSLNALVGKVGIEAYCDGSLRGQLGKKTV
FT                   LVDRRGNFIQGLHEVEAISGKKLQLTLSTELQAFADALLLDHEKTEQFRSAQSLKKQKF
FT                   LPPLFPWIKGGAIIALDPNNGQILAMASSPRYHNNDFIDIRDADSEARSAVYRWLENTE
FT                   HIAEVYDRKVPLRRERRSSLTGLCYDEELSLTFDYFLDFILPNTSEVKSVIQRYGTVHN
FT                   AVKIQHAMERLLEVFSYSEGHCSCSSIFDAVFPVEQEHIAIGRVISIKQQQWIARCHKA
FT                   HEQEIEEIKQELEPFFAELPANYDKLLLVDLFQLVVDPSKIDPELLASVASFSLSEFFE
FT                   CQGHYVALRSAFSKIVEDIFTEVDFKEWRKLYFAKFLEVKRKEENERKQRYPTPYVDYL
FT                   VEEQRAQYQDFRRCYLDRFLAYLLSGQGDIENQKAYYEALSVWKRELENGAHQALPWYE
FT                   HYEFLKQKFSDSSIDLLRLFVSFREFLELQRPLYGNYAPMLTRNVPQKEQDLAAAFYPT
FT                   YGYGYLRSHAFGQAATLGSIFKLVSAYSVLSQEVMRGNVDVDYLSRLLVIIDRKSFGYA
FT                   STKPHVGFFKDGTPIPSFYRGGILPKNDYSGRGRIDLISALEMSSNPYFSLLVGEYLSD
FT                   PEDLCHAAALFGFGEKTGVGLLGEYAGAVPQDVAYNRSGLYATAIGQHTLIVTPLQTAV
FT                   MMAALVNGGTVYVPSLVLGEWDGEEFSPTPPMKKRDVFMPECITELFKSGMHNVIWGNY
FT                   GTTRSIRDQFSPELLTRIIGKTSTAESIVRVGLDRQYGSMKMKHVWFAAVGFSDEELMH
FT                   PDIVVIVYLRLGEFGRDAAPIAVKMIEKWENIRKKEKFSAMN"
     MKSPKKRRSY LTVPEKTNRL LSGIIVALAI IAVRLWHLAV VEHDQKLEEA YKPQKRVIPE        60
     LIERATICDR FGKVLAENKM QYDVSVAYSA IRDLPTRAWR ARADGTRELI PVRKNYIARL       120
     AQLLAQELHL DKDTIEDNIH AKASVLGSVP YVVQANVSER TYLGLKMMMK HWPGLHVEPS       180
     VRRYYPMGKT ASDILGYVGP ISAQEYKSVT HELSKLRECV RAYEEGENPK FPEGLASIDQ       240
     VRSLLNSLEN NAYSLNALVG KVGIEAYCDG SLRGQLGKKT VLVDRRGNFI QGLHEVEAIS       300
     GKKLQLTLST ELQAFADALL LDHEKTEQFR SAQSLKKQKF LPPLFPWIKG GAIIALDPNN       360
     GQILAMASSP RYHNNDFIDI RDADSEARSA VYRWLENTEH IAEVYDRKVP LRRERRSSLT       420
     GLCYDEELSL TFDYFLDFIL PNTSEVKSVI QRYGTVHNAV KIQHAMERLL EVFSYSEGHC       480
     SCSSIFDAVF PVEQEHIAIG RVISIKQQQW IARCHKAHEQ EIEEIKQELE PFFAELPANY       540
     DKLLLVDLFQ LVVDPSKIDP ELLASVASFS LSEFFECQGH YVALRSAFSK IVEDIFTEVD       600
     FKEWRKLYFA KFLEVKRKEE NERKQRYPTP YVDYLVEEQR AQYQDFRRCY LDRFLAYLLS       660
     GQGDIENQKA YYEALSVWKR ELENGAHQAL PWYEHYEFLK QKFSDSSIDL LRLFVSFREF       720
     LELQRPLYGN YAPMLTRNVP QKEQDLAAAF YPTYGYGYLR SHAFGQAATL GSIFKLVSAY       780
     SVLSQEVMRG NVDVDYLSRL LVIIDRKSFG YASTKPHVGF FKDGTPIPSF YRGGILPKND       840
     YSGRGRIDLI SALEMSSNPY FSLLVGEYLS DPEDLCHAAA LFGFGEKTGV GLLGEYAGAV       900
     PQDVAYNRSG LYATAIGQHT LIVTPLQTAV MMAALVNGGT VYVPSLVLGE WDGEEFSPTP       960
     PMKKRDVFMP ECITELFKSG MHNVIWGNYG TTRSIRDQFS PELLTRIIGK TSTAESIVRV      1020
     GLDRQYGSMK MKHVWFAAVG FSDEELMHPD IVVIVYLRLG EFGRDAAPIA VKMIEKWENI      1080
     RKKEKFSAMN                                                             1090
//

If you have problems or comments...

PBIL Back to PBIL home page