(data stored in SCRATCH zone)

EMBL: CR848038.PE56

CR848038.PE56        Location/Qualifiers
FT   CDS             complement(70256..70909)
FT                   /transl_table=11
FT                   /locus_tag="CAB056"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical protein
FT                   cpn0687 or cp0059 SWALL:Q9Z7L7 (EMBL:AE001651) (217 aa)
FT                   fasta scores: E(): 2.7e-47, 58.33% id in 216 aa. Only
FT                   significant database matches are to predicted Chlamydiaceae
FT                   proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63514"
FT                   /db_xref="GOA:Q5L754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L754"
FT                   /protein_id="CAH63514.1"
FT                   /translation="MKNLLSLVWKRVYSYSFTLTFLITLSIFLTGKIIYHLQKNDREKH
FT                   ESILLLTKTAESAVFQGFIPPKTALPMLERAYRMGGKSVQPYAGFLSSCFYIHNEPLRG
FT                   AYYAGLAFGSGSHFRMPSPAQVLLKEIADAQATEDYQTALEKSSQLLQFTASSADYPTL
FT                   RFLTLLRIIEIKEILNQDTSIDFEELKALPLFKEFEQFYKDGEWTLTKRFGKKH"
     MKNLLSLVWK RVYSYSFTLT FLITLSIFLT GKIIYHLQKN DREKHESILL LTKTAESAVF        60
     QGFIPPKTAL PMLERAYRMG GKSVQPYAGF LSSCFYIHNE PLRGAYYAGL AFGSGSHFRM       120
     PSPAQVLLKE IADAQATEDY QTALEKSSQL LQFTASSADY PTLRFLTLLR IIEIKEILNQ       180
     DTSIDFEELK ALPLFKEFEQ FYKDGEWTLT KRFGKKH                                217
//

If you have problems or comments...

PBIL Back to PBIL home page