(data stored in SCRATCH zone)

EMBL: CR848038.PE72

CR848038.PE72        Location/Qualifiers
FT   CDS             complement(86227..87183)
FT                   /transl_table=11
FT                   /locus_tag="CAB073"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Chlamydia pneumoniae ct547 hypothetical
FT                   protein cpn0668 or cpj0668 SWALL:Q9Z7N6 (EMBL:AE001649)
FT                   (318 aa) fasta scores: E(): 2.4e-85, 69.81% id in 318 aa.
FT                   Only significant database matches are to predicted
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63530"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L740"
FT                   /protein_id="CAH63530.1"
FT                   /translation="MKSVLQFVVFLLLLSSGCYARPISFEPFSGKLSPQKFTPKYSTQE
FT                   YLSEGKRYLEQQRYRKALLCFGMITHHFPQDPLYSEALYLTGVCYFKNDQPDLAEKAFS
FT                   AYLQLPDANYSEELFLMKYSIAKSFAQGKRKRIFLLEGFPKLANADADALRIYDEILTA
FT                   FPNKDLGAQALYLKGDLLVTKKDFPEAIKTFKKLTLQFSAHPLSPKSFVRLSEIYLMQA
FT                   QKEPHNLQYLNLAKINEEAIAKQHPNHPLNSVVSANVRSMCERYALGLYSTGRFYEKKK
FT                   KPHAASIYYTTAIENYPESSLVAKCHKRLNRITKHSS"
     MKSVLQFVVF LLLLSSGCYA RPISFEPFSG KLSPQKFTPK YSTQEYLSEG KRYLEQQRYR        60
     KALLCFGMIT HHFPQDPLYS EALYLTGVCY FKNDQPDLAE KAFSAYLQLP DANYSEELFL       120
     MKYSIAKSFA QGKRKRIFLL EGFPKLANAD ADALRIYDEI LTAFPNKDLG AQALYLKGDL       180
     LVTKKDFPEA IKTFKKLTLQ FSAHPLSPKS FVRLSEIYLM QAQKEPHNLQ YLNLAKINEE       240
     AIAKQHPNHP LNSVVSANVR SMCERYALGL YSTGRFYEKK KKPHAASIYY TTAIENYPES       300
     SLVAKCHKRL NRITKHSS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page