(data stored in SCRATCH zone)

EMBL: CR848038.PE8

CR848038.PE8         Location/Qualifiers
FT   CDS             complement(11028..14096)
FT                   /transl_table=11
FT                   /locus_tag="CAB008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proposed exodeoxyribonuclease V
FT                   proteins including: Chlamydia pneumoniae
FT                   exodeoxyribonuclease V, gamma subunit cpn0737 SWALL:Q9Z7G8
FT                   (EMBL:AE001655) (1024 aa) fasta scores: E(): 4.1e-215,
FT                   52.87% id in 1027 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63466"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L7A2"
FT                   /protein_id="CAH63466.1"
FT                   /translation="MNATKHSQAIFSNSPIHLLAKLAEDLFSTYQQPFTKRWILVANTE
FT                   IGHWLRRELTNATSNHIFMGSTIFSSSDSLIKHLFTEVCHEKPLIPDYITLPLFIHELL
FT                   KTSAATPNILQNPSFLSEPSYSSTKHLAAIFKKFYTFSQAPSENNRYHKDLFSQLEKHF
FT                   MPMGKVFASILSSVKVKKQNRSLHIFGYSHLPRHFATFFTKLSNFFPVYFYCFSPSREY
FT                   FGDLLSDKSIDFLWRQLIDQPNRDAWQHYVLTDRQALLANLSHKSQASQNFFLDKEIHY
FT                   SEVFIPPQETTSLGVVQSNLFHLKPSSHENIADKKQTITISKALSPSREVQEVFSKISI
FT                   LLHQGVRPEEIFILSSQLEIYEVYLKAVFSPHLPLYCCNNTSSHAEDLKEKLLLLSSIL
FT                   QTQGNLYRLLQLLTHPQLQNPIDPSKTPYLLNKLSSEWEKLYKGDGTHLQHLGDNILHD
FT                   YPFVEECGKVSQVELWERILPLLYDLQKFLDLYASTTIKSYEEHCNHILSFLESLFILS
FT                   PEELSFITSLRNALFPAFSSSECSLKFFTDFCLDFFSRFCANSPLYDKPGPYVGTLGDL
FT                   SLIPKGYTFILGANKQKQAIDLLDLVDASTEEELVFSSSEDEENFHFLQVIVSTKYELH
FT                   MSYPSSAHNPALPSAYIHYLQEALQLPVSHLPTKAYIPSLFADTTLVHTSQEHYYKLAQ
FT                   AFCSKKEPLPSLFQTPDTTPNLPDHLSVSQIIKAIFSPLDFFLKSNYQISLRSPTVLES
FT                   REKLFPTKKHILMFWENRLSNTSEDHTYNYLSSFSEAMFTYYDDLIAQWLNTVRLNPLT
FT                   APYTVLFSSSLFHDHLADQDQVLSPVSLTLNNSELYLHGNFSGVFSKGIYLCSIDPTAK
FT                   TRKTVRKTKSILENPADMKNYLKAYIAIAMLQKSGVLSEHAVIRNILSQEVFEDLPLPF
FT                   SHPDNYLHQVLRVYQMMRDFPIPLISSDCWKFLDNAEKFHEAIHTAIEADVNNPSLSTF
FT                   WKFHNRDYKEQFTVSEEQRLLILSLFKGAHETV"
     MNATKHSQAI FSNSPIHLLA KLAEDLFSTY QQPFTKRWIL VANTEIGHWL RRELTNATSN        60
     HIFMGSTIFS SSDSLIKHLF TEVCHEKPLI PDYITLPLFI HELLKTSAAT PNILQNPSFL       120
     SEPSYSSTKH LAAIFKKFYT FSQAPSENNR YHKDLFSQLE KHFMPMGKVF ASILSSVKVK       180
     KQNRSLHIFG YSHLPRHFAT FFTKLSNFFP VYFYCFSPSR EYFGDLLSDK SIDFLWRQLI       240
     DQPNRDAWQH YVLTDRQALL ANLSHKSQAS QNFFLDKEIH YSEVFIPPQE TTSLGVVQSN       300
     LFHLKPSSHE NIADKKQTIT ISKALSPSRE VQEVFSKISI LLHQGVRPEE IFILSSQLEI       360
     YEVYLKAVFS PHLPLYCCNN TSSHAEDLKE KLLLLSSILQ TQGNLYRLLQ LLTHPQLQNP       420
     IDPSKTPYLL NKLSSEWEKL YKGDGTHLQH LGDNILHDYP FVEECGKVSQ VELWERILPL       480
     LYDLQKFLDL YASTTIKSYE EHCNHILSFL ESLFILSPEE LSFITSLRNA LFPAFSSSEC       540
     SLKFFTDFCL DFFSRFCANS PLYDKPGPYV GTLGDLSLIP KGYTFILGAN KQKQAIDLLD       600
     LVDASTEEEL VFSSSEDEEN FHFLQVIVST KYELHMSYPS SAHNPALPSA YIHYLQEALQ       660
     LPVSHLPTKA YIPSLFADTT LVHTSQEHYY KLAQAFCSKK EPLPSLFQTP DTTPNLPDHL       720
     SVSQIIKAIF SPLDFFLKSN YQISLRSPTV LESREKLFPT KKHILMFWEN RLSNTSEDHT       780
     YNYLSSFSEA MFTYYDDLIA QWLNTVRLNP LTAPYTVLFS SSLFHDHLAD QDQVLSPVSL       840
     TLNNSELYLH GNFSGVFSKG IYLCSIDPTA KTRKTVRKTK SILENPADMK NYLKAYIAIA       900
     MLQKSGVLSE HAVIRNILSQ EVFEDLPLPF SHPDNYLHQV LRVYQMMRDF PIPLISSDCW       960
     KFLDNAEKFH EAIHTAIEAD VNNPSLSTFW KFHNRDYKEQ FTVSEEQRLL ILSLFKGAHE      1020
     TV                                                                     1022
//

If you have problems or comments...

PBIL Back to PBIL home page