(data stored in SCRATCH zone)

EMBL: CR848038.PMP14G

CR848038.PMP14G      Location/Qualifiers
FT   CDS             complement(324168..326948)
FT                   /transl_table=11
FT                   /gene="pmp14G"
FT                   /gene_synonym="pomp98A"
FT                   /locus_tag="CAB282"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="Previously sequenced as: Chlamydophila abortus
FT                   putative outer membrane protein SWALL:P71135 (EMBL:U72499)
FT                   (926 aa) fasta scores: E(): 0, 99.89% id in 926 aa. Also
FT                   highly similar to Chlamydia pneumoniae probable outer
FT                   membrane protein Pmp10 precursor or omp5 or cp0303
FT                   SWALL:PM10_CHLPN (SWALL:Q9RB65) (928 aa) fasta scores: E():
FT                   9.4e-144, 46.84% id in 952 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB282"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63732"
FT                   /db_xref="GOA:Q5L6J3"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6J3"
FT                   /protein_id="CAH63732.1"
FT                   /translation="MRPSLYKILISSTLTIPISFHFSQLHAEVALTQESILDANGAFSP
FT                   QSTSTAGGTIYNVESDISIVDVGQTAALASSAFVQTADNLTFKGNNHSLSITNANAGAN
FT                   PAGINVNTADKILTLTDFSKLSFKECPSSLVNTGKGAMKSGGALNLANNASILFDQNYS
FT                   AENGGAISCKAFSLTGSSKEISFTTNSTAKKGGAIAATGIAHLSDNQGTIRFSGNTAVN
FT                   SGGAVYSEASMTIAGNNHVAFSNNAVSGSSDGCGGAIHCSKTGSAPTLTIRDNKVLIFE
FT                   ENTSSAKGGAIYTDKLILTSGGPTAFINNKVTHATPKGGAIGIAANGECSLTAEHGDIT
FT                   FDNNLMATQDNATIKRNAINIEGNGKFVNLRAASGKTISFYDPITVEGNAADLLTLNKA
FT                   EGDKTYNGRIIFSGEKLTEEQAAVADNLKTTFTQPITLAAGELVLRSGVEVEAKTVVQT
FT                   AGSLILMDAGTKLSAKTEDATLTNLAINPNTLDGKKFAVVDAVAAGKNVTLSGAIGVID
FT                   PTGKFYENHKLNDTLALGGIQLSGKGSVTTTNVPSHVVGVAETHYGYQGNWSVSWVKDN
FT                   NSDPKTQTAIFTWNKTGYVPNPERRAPLVLNSLWGSFIDLRSIQDVLERSVDSILETRR
FT                   GLWVSGIGNFFHKDRNAENRKFRHISSGYVLGATTNTSREDSLSVAFCQLFAKDKDYLV
FT                   SKNAANVYAGSVYYQHVSKFDDLTRLFNGPNTCCSGFSKEIPIFLDAQITYCHTANNMT
FT                   TSYTDYPEVKGSWGNDTLGLTLSTSVPIPVFSSSIFDSYAPFAKLQVVYAHQDDFKEPT
FT                   TEGRVFESSDLLNVSVPIGIKFEKLSYGERSAYDLTLMYIPDVYRHNPSCMTGLAINDV
FT                   SWLTTATNLARQAFIVRAGNHIALTSGVEMFSQFGFELRSSSRNYNVDLGAKVAF"
     MRPSLYKILI SSTLTIPISF HFSQLHAEVA LTQESILDAN GAFSPQSTST AGGTIYNVES        60
     DISIVDVGQT AALASSAFVQ TADNLTFKGN NHSLSITNAN AGANPAGINV NTADKILTLT       120
     DFSKLSFKEC PSSLVNTGKG AMKSGGALNL ANNASILFDQ NYSAENGGAI SCKAFSLTGS       180
     SKEISFTTNS TAKKGGAIAA TGIAHLSDNQ GTIRFSGNTA VNSGGAVYSE ASMTIAGNNH       240
     VAFSNNAVSG SSDGCGGAIH CSKTGSAPTL TIRDNKVLIF EENTSSAKGG AIYTDKLILT       300
     SGGPTAFINN KVTHATPKGG AIGIAANGEC SLTAEHGDIT FDNNLMATQD NATIKRNAIN       360
     IEGNGKFVNL RAASGKTISF YDPITVEGNA ADLLTLNKAE GDKTYNGRII FSGEKLTEEQ       420
     AAVADNLKTT FTQPITLAAG ELVLRSGVEV EAKTVVQTAG SLILMDAGTK LSAKTEDATL       480
     TNLAINPNTL DGKKFAVVDA VAAGKNVTLS GAIGVIDPTG KFYENHKLND TLALGGIQLS       540
     GKGSVTTTNV PSHVVGVAET HYGYQGNWSV SWVKDNNSDP KTQTAIFTWN KTGYVPNPER       600
     RAPLVLNSLW GSFIDLRSIQ DVLERSVDSI LETRRGLWVS GIGNFFHKDR NAENRKFRHI       660
     SSGYVLGATT NTSREDSLSV AFCQLFAKDK DYLVSKNAAN VYAGSVYYQH VSKFDDLTRL       720
     FNGPNTCCSG FSKEIPIFLD AQITYCHTAN NMTTSYTDYP EVKGSWGNDT LGLTLSTSVP       780
     IPVFSSSIFD SYAPFAKLQV VYAHQDDFKE PTTEGRVFES SDLLNVSVPI GIKFEKLSYG       840
     ERSAYDLTLM YIPDVYRHNP SCMTGLAIND VSWLTTATNL ARQAFIVRAG NHIALTSGVE       900
     MFSQFGFELR SSSRNYNVDL GAKVAF                                            926
//

If you have problems or comments...

PBIL Back to PBIL home page