(data stored in SCRATCH zone)

EMBL: CR848038.PMP15G

CR848038.PMP15G      Location/Qualifiers
FT   CDS             complement(327092..331228)
FT                   /transl_table=11
FT                   /gene="pmp15G"
FT                   /gene_synonym="pomp145A"
FT                   /locus_tag="CAB283"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="Similar to Chlamydia pneumoniae probable outer
FT                   membrane protein pmp6 precursor pmp6 or cpn0444 or cp0309
FT                   SWALL:PMP6_CHLPN (SWALL:Q9Z899) (1276 aa) fasta scores:
FT                   E(): 2.8e-57, 30.65% id in 1450aa. Also highly similar to
FT                   Chlamydophila abortus putative outer membrane protein (gene
FT                   fragment) SWALL:P71134 (EMBL:U72499) (649 aa) fasta scores:
FT                   E(): 1.7e-204, 99.84% id in 649 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB283"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63733"
FT                   /db_xref="GOA:Q5L6J2"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6J2"
FT                   /protein_id="CAH63733.1"
FT                   /translation="MSNPFYHQKNLVMKSSVPWLLISSAITFPLSSLATEKAALSSAPQ
FT                   NTGEQTLSSSDNYDGSSSSDTPFTCKNSSFASGTTYTLTSDVSFTNVSKTQDPKSQQST
FT                   AESQNSSQDTDKTDSPSAPTTDQSSDIENNKDSKGEEEENHPPHVLPEHSPTVDTGEEV
FT                   TAPTEVPGTSETIETVGTPGASGTQGAPEDKQDKESSEEAGSTKVEEKTEADHEAKETE
FT                   KEKETLESSLPHTPLSFTASSDVANEHGSPSPETKTPPTAVASQANGETNKSCFSNTDG
FT                   SLTFVGGNHSLTFSNISVTAPGSAINNSAGSALTFSGFKDLSFVCATNQDQTKADSAIY
FT                   VGPKATSGDGELSVQAEGSKANSHTEGSVNTALIKYAGIPADATATNGESQEDPATNVA
FT                   PATQGGAEKEEAANSPDIILKQNVNITFSSNSSKTAGGAIRVSGSATIENNTGTCTFSN
FT                   NNAKEQGGAISVNGNCDITGNKNVVFSGNQAQEIPAPSIVTVEEAAVEEPVEAKGSGGA
FT                   IYCVKAPISIPATPIQPPKQTLPSLKSAALSGETHAKVAQKEEPSPDPCLTISGNASVI
FT                   FDNNSSTVTGGAIHAKKVVLSSSGNMTFSNNSSGKGGAIYIADGGDISITATTGSIIFQ
FT                   GNKVTAADSITLPTKKEIAIAAESIEEKTDPSQASGSASAGMTSAFFTLANKAEIPAES
FT                   QAKENSKPTCNSIHLGSGAKISQLRAQTGQTIFFYDPITTTAPAAAAVVTAKQPEASLA
FT                   KATSGIPASASAVSVPAPAPTKTPLKINAPDTQDPEIQKVAAEAAQQSAVYNGKIVFSG
FT                   EKLSSEDAKNPLNATSVIHNDVSLEAGTLVLSSGAGLLVDSFTQKEGSLIVMDGGTSII
FT                   TNVTPASEGLQSRSTPPSPKNAIPVIRAVSKVIASSLINLRERADSGAGAVVPTIEESP
FT                   DGSITITNLAVNLDSLENGKVITLAAKGGSGSVTLTGDLQFQDSSQNFYDNPLLNKNFT
FT                   LNFLDISAPDAEKIHTEGFNIIPQGATSSNLGYQGKWEVTEVKDSSGKVSFEMKWVSTG
FT                   YIPTANRRATLVPNSVWCSAIDMRAFQNLVEVSTEGEDFHRGLWISGISNFFHKDSTKV
FT                   QEGFRHISSGYVVGVSTQPISNKVMDLAFCQMLGKSKDYRLADARSHVYAASIHTKCEK
FT                   LVNHYTFSKRKGAILARKPEKSPIIFDAQLSYSLSHNSMTTKHTPNPSSRGKWNNHCVA
FT                   GELGSYLPILVDHPAIEELFPFVKLHIVFVQQEDFKETQGGTENRNFQSAHFVNVSLPL
FT                   GVRFEKTNKLNTYNIRLAYQPDIYRDAPKSKVFLPSVHTAWSTGATNLSRQAMILDGSD
FT                   HHHLTDNLEVFCHGAFELRGSSRNYNVDIGGRYKF"
     MSNPFYHQKN LVMKSSVPWL LISSAITFPL SSLATEKAAL SSAPQNTGEQ TLSSSDNYDG        60
     SSSSDTPFTC KNSSFASGTT YTLTSDVSFT NVSKTQDPKS QQSTAESQNS SQDTDKTDSP       120
     SAPTTDQSSD IENNKDSKGE EEENHPPHVL PEHSPTVDTG EEVTAPTEVP GTSETIETVG       180
     TPGASGTQGA PEDKQDKESS EEAGSTKVEE KTEADHEAKE TEKEKETLES SLPHTPLSFT       240
     ASSDVANEHG SPSPETKTPP TAVASQANGE TNKSCFSNTD GSLTFVGGNH SLTFSNISVT       300
     APGSAINNSA GSALTFSGFK DLSFVCATNQ DQTKADSAIY VGPKATSGDG ELSVQAEGSK       360
     ANSHTEGSVN TALIKYAGIP ADATATNGES QEDPATNVAP ATQGGAEKEE AANSPDIILK       420
     QNVNITFSSN SSKTAGGAIR VSGSATIENN TGTCTFSNNN AKEQGGAISV NGNCDITGNK       480
     NVVFSGNQAQ EIPAPSIVTV EEAAVEEPVE AKGSGGAIYC VKAPISIPAT PIQPPKQTLP       540
     SLKSAALSGE THAKVAQKEE PSPDPCLTIS GNASVIFDNN SSTVTGGAIH AKKVVLSSSG       600
     NMTFSNNSSG KGGAIYIADG GDISITATTG SIIFQGNKVT AADSITLPTK KEIAIAAESI       660
     EEKTDPSQAS GSASAGMTSA FFTLANKAEI PAESQAKENS KPTCNSIHLG SGAKISQLRA       720
     QTGQTIFFYD PITTTAPAAA AVVTAKQPEA SLAKATSGIP ASASAVSVPA PAPTKTPLKI       780
     NAPDTQDPEI QKVAAEAAQQ SAVYNGKIVF SGEKLSSEDA KNPLNATSVI HNDVSLEAGT       840
     LVLSSGAGLL VDSFTQKEGS LIVMDGGTSI ITNVTPASEG LQSRSTPPSP KNAIPVIRAV       900
     SKVIASSLIN LRERADSGAG AVVPTIEESP DGSITITNLA VNLDSLENGK VITLAAKGGS       960
     GSVTLTGDLQ FQDSSQNFYD NPLLNKNFTL NFLDISAPDA EKIHTEGFNI IPQGATSSNL      1020
     GYQGKWEVTE VKDSSGKVSF EMKWVSTGYI PTANRRATLV PNSVWCSAID MRAFQNLVEV      1080
     STEGEDFHRG LWISGISNFF HKDSTKVQEG FRHISSGYVV GVSTQPISNK VMDLAFCQML      1140
     GKSKDYRLAD ARSHVYAASI HTKCEKLVNH YTFSKRKGAI LARKPEKSPI IFDAQLSYSL      1200
     SHNSMTTKHT PNPSSRGKWN NHCVAGELGS YLPILVDHPA IEELFPFVKL HIVFVQQEDF      1260
     KETQGGTENR NFQSAHFVNV SLPLGVRFEK TNKLNTYNIR LAYQPDIYRD APKSKVFLPS      1320
     VHTAWSTGAT NLSRQAMILD GSDHHHLTDN LEVFCHGAFE LRGSSRNYNV DIGGRYKF        1378
//

If you have problems or comments...

PBIL Back to PBIL home page