(data stored in SCRATCH zone)

EMBL: CR848038.PMP3E

CR848038.PMP3E       Location/Qualifiers
FT   CDS             complement(293548..296514)
FT                   /transl_table=11
FT                   /gene="pmp3E"
FT                   /locus_tag="CAB265"
FT                   /product="polymorphic outer membrane lipoprotein"
FT                   /note="Similar to many Chlamydial outer membrane proteins
FT                   including: C.trachomatis probable outer membrane protein
FT                   Pmpf precursor or ct870 SWALL:PMPF_CHLTR (SWALL:P38008)
FT                   (1034 aa) fasta scores: E(): 1.7e-21, 28.99% id in 1083 aa
FT                   and to Chlamydia pneumoniae probable outer membrane protein
FT                   Pmp10 precursor or omp5 or cp0303 SWALL:PM10_CHLPN
FT                   (SWALL:Q9RB65) (928 aa) fasta scores: E(): 3.2e-08, 24.13%
FT                   id in 1036 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB265"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63721"
FT                   /db_xref="GOA:Q5L6K1"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6K1"
FT                   /protein_id="CAH63721.1"
FT                   /translation="MKMKLSTLLNAYLLTSLLSCLPLFSEAYLKDIDALNEQLLGYEHL
FT                   FDLEMFSNISEPQNTLKGLRSSSGYCTIENYNNIACTKQVAKSNGAVFNASSLTLRNNT
FT                   GDIKFICNSTNAKGGVIWTSGSCNISENSSRQYFINNHAINIESAQSNSTNFGGAICCK
FT                   TFELTKNCGPICFADNIAQMNGGAISSDELLKISENSSPILFLNNRAFFRNARMTSRGG
FT                   ALYCQNCEISANSAPLYFISNSSPIGGACYVTRTHTIKNNTGAIVFSNNFSSCNDTKGS
FT                   NSSGGAVTCTDLNIEDNPGPVYFNNNIAYRNGGAIYCTRVTIKNSGPVQFANNQSKWGG
FT                   AILINHNGSCDISADYGDIVFVNNSGIGDFDLFKNSLHCTRSVTLKVGAKKNYAVKFYD
FT                   PIECQYYSPSVVFNEQEDQQGTVLFSSMFLPFSSSRHVRDYTTYIRNPIEIKHGILAVE
FT                   DGACIAINKITQDNSILRLGNGAGIQTNEFFTTRLVNNLIISSPEEGSEAEPGSAPTAP
FT                   KSSEEPAPRSINADLQITRLALNLPSLLQKGAKAPKIWIYPSATTSNGITTYSEDDTSS
FT                   ATLSGPLLLLDSENEDPYDSLDLSIGITRIPLLYLCDNATPKITTTALDIEAINEKQHY
FT                   GYQGVWSPYWEEYKTTANGKTPETTNTNHRYLYTNWTPTGYIPNPKYMTPLIANALWGT
FT                   LYTTLSGLRTLPSSMTAPTYFELGGQGLVTAIHQANRLGVPGFRMESAGYSAGTTVTTT
FT                   NNHRVSVSFAQQSVHIKEKESKNKLSSRNYFGGTLIQMPWLDESIITSASLAYNYGSHT
FT                   AKHFYVKDDKESEGDFYTHSFAGSVNCIFNLTPITKDFSITPFLEVLAFRATLSSFVEH
FT                   GDFPRAFTVKRPLTNISLPTGLMIQWTRNAQLPTIWQVQLTYQPVVLKRHPKVLTTLLA
FT                   SKGTWSSLGTPISRHAFAYKIGNESRIFPYLKIFLNYQGDISSSTFSNYLKAGSSLIF"
     MKMKLSTLLN AYLLTSLLSC LPLFSEAYLK DIDALNEQLL GYEHLFDLEM FSNISEPQNT        60
     LKGLRSSSGY CTIENYNNIA CTKQVAKSNG AVFNASSLTL RNNTGDIKFI CNSTNAKGGV       120
     IWTSGSCNIS ENSSRQYFIN NHAINIESAQ SNSTNFGGAI CCKTFELTKN CGPICFADNI       180
     AQMNGGAISS DELLKISENS SPILFLNNRA FFRNARMTSR GGALYCQNCE ISANSAPLYF       240
     ISNSSPIGGA CYVTRTHTIK NNTGAIVFSN NFSSCNDTKG SNSSGGAVTC TDLNIEDNPG       300
     PVYFNNNIAY RNGGAIYCTR VTIKNSGPVQ FANNQSKWGG AILINHNGSC DISADYGDIV       360
     FVNNSGIGDF DLFKNSLHCT RSVTLKVGAK KNYAVKFYDP IECQYYSPSV VFNEQEDQQG       420
     TVLFSSMFLP FSSSRHVRDY TTYIRNPIEI KHGILAVEDG ACIAINKITQ DNSILRLGNG       480
     AGIQTNEFFT TRLVNNLIIS SPEEGSEAEP GSAPTAPKSS EEPAPRSINA DLQITRLALN       540
     LPSLLQKGAK APKIWIYPSA TTSNGITTYS EDDTSSATLS GPLLLLDSEN EDPYDSLDLS       600
     IGITRIPLLY LCDNATPKIT TTALDIEAIN EKQHYGYQGV WSPYWEEYKT TANGKTPETT       660
     NTNHRYLYTN WTPTGYIPNP KYMTPLIANA LWGTLYTTLS GLRTLPSSMT APTYFELGGQ       720
     GLVTAIHQAN RLGVPGFRME SAGYSAGTTV TTTNNHRVSV SFAQQSVHIK EKESKNKLSS       780
     RNYFGGTLIQ MPWLDESIIT SASLAYNYGS HTAKHFYVKD DKESEGDFYT HSFAGSVNCI       840
     FNLTPITKDF SITPFLEVLA FRATLSSFVE HGDFPRAFTV KRPLTNISLP TGLMIQWTRN       900
     AQLPTIWQVQ LTYQPVVLKR HPKVLTTLLA SKGTWSSLGT PISRHAFAYK IGNESRIFPY       960
     LKIFLNYQGD ISSSTFSNYL KAGSSLIF                                          988
//

If you have problems or comments...

PBIL Back to PBIL home page