(data stored in SCRATCH zone)

EMBL: CR848038.PYRE

CR848038.PYRE        Location/Qualifiers
FT   CDS             139387..140043
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CAB131"
FT                   /product="putative orotate phosphoribosyltransferase"
FT                   /note="Similar to many Eukaryotic and Prokaryotic proteins
FT                   involved in pyrimidine biosynthesis including: Chlamydia
FT                   pneumoniae orotate phosphoribosyltransferase PyrE or
FT                   cpn0608 or cp0139 or cpj0608 SWALL:PYRE_CHLPN
FT                   (SWALL:Q9Z7U6) (210 aa) fasta scores: E(): 1.5e-45, 61.88%
FT                   id in 202 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB131"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63589"
FT                   /db_xref="GOA:Q5L6Y1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6Y1"
FT                   /protein_id="CAH63589.1"
FT                   /translation="MYFVKKTRGYWVMMSFEEKQLRDHAVMNLYRIGAIQFGDFNLADG
FT                   QTTPIYVDMRLVISCPNVLQTIASLIWCLRPSFNSSLLCGVPYTALALATCISLKYNIS
FT                   MVLRRKELKHSSQTDRIKVEGLFSPGQTCLVINDVVASGQSILETAKALEDEGVNIRES
FT                   LVFLDRQVGGADALKDAGIKLRSVFTLEELVQSLLSKCELKEADAAIASTLLKSL"
     MYFVKKTRGY WVMMSFEEKQ LRDHAVMNLY RIGAIQFGDF NLADGQTTPI YVDMRLVISC        60
     PNVLQTIASL IWCLRPSFNS SLLCGVPYTA LALATCISLK YNISMVLRRK ELKHSSQTDR       120
     IKVEGLFSPG QTCLVINDVV ASGQSILETA KALEDEGVNI RESLVFLDRQ VGGADALKDA       180
     GIKLRSVFTL EELVQSLLSK CELKEADAAI ASTLLKSL                               218
//

If you have problems or comments...

PBIL Back to PBIL home page