(data stored in SCRATCH zone)

EMBL: CR848038.RECF

CR848038.RECF        Location/Qualifiers
FT   CDS             complement(496287..497390)
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CAB430"
FT                   /product="DNA replication and repair protein"
FT                   /note="Similar to Bacillus halodurans DNA replication and
FT                   repair protein RecF or bh0004 SWALL:RECF_BACHD
FT                   (SWALL:Q9RC99) (371 aa) fasta scores: E(): 4.8e-34, 35.12%
FT                   id in 373 aa and Clostridium acetobutylicum DNA replication
FT                   and repair protein RecF or cac0004 SWALL:RECF_CLOAB
FT                   (SWALL:Q97N32) (363 aa) fasta scores: E(): 1.1e-33, 32.32%
FT                   id in 365 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB430"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63883"
FT                   /db_xref="GOA:Q5L648"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L648"
FT                   /protein_id="CAH63883.1"
FT                   /translation="MNILSLRLKNFRNYKEAEVSLSPNINYIFGENAQGKTNLIEALYV
FT                   LSLGRSFRTSHLTEAIFFGSSYFFLEMTFEKDGVPHTLSTYVDKHGKKIFCDQSPIKTL
FT                   SQLIGMIPIVLFSAKDRCLIAGAPSDRRLFLNLLLSQCDPQYKHSLSYYHRALLQRNTL
FT                   LKTKQTSTLSVWDEQLATLGSYLCLSRYTCCAQLNQLIQTLWNNSLSERLFIKFKSSLI
FT                   KQCKISQEAVKNELHKQLTASLHRDLELGNTSVGPHREDFTLMINDLPVAQFSSEGQKH
FT                   SLLAVLKLAESLYIKSLHNVYPLFCMDDIHAGLDNQRISQLLGLAPSLGQTLITSTTLP
FT                   HQTLSEANRIFSVNQAQISIHSHAIIK"
     MNILSLRLKN FRNYKEAEVS LSPNINYIFG ENAQGKTNLI EALYVLSLGR SFRTSHLTEA        60
     IFFGSSYFFL EMTFEKDGVP HTLSTYVDKH GKKIFCDQSP IKTLSQLIGM IPIVLFSAKD       120
     RCLIAGAPSD RRLFLNLLLS QCDPQYKHSL SYYHRALLQR NTLLKTKQTS TLSVWDEQLA       180
     TLGSYLCLSR YTCCAQLNQL IQTLWNNSLS ERLFIKFKSS LIKQCKISQE AVKNELHKQL       240
     TASLHRDLEL GNTSVGPHRE DFTLMINDLP VAQFSSEGQK HSLLAVLKLA ESLYIKSLHN       300
     VYPLFCMDDI HAGLDNQRIS QLLGLAPSLG QTLITSTTLP HQTLSEANRI FSVNQAQISI       360
     HSHAIIK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page