(data stored in SCRATCH zone)

EMBL: CR848038.RPLO

CR848038.RPLO        Location/Qualifiers
FT   CDS             116336..116770
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CAB109"
FT                   /product="putative 50S ribosomal protein l15"
FT                   /note="Similar to Chlamydia pneumoniae 50S ribosomal
FT                   protein l15 RplO or Rl15 or cpn0630 or cp0117
FT                   SWALL:RL15_CHLPN (SWALL:Q9Z7S4) (144 aa) fasta scores: E():
FT                   3.6e-43, 82.51% id in 143 aa, and to Bacillus subtilis 50S
FT                   ribosomal protein l15 RplO SWALL:RL15_BACSU (SWALL:P19946)
FT                   (146 aa) fasta scores: E(): 1.6e-11, 41.73% id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB109"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63567"
FT                   /db_xref="GOA:Q5L703"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L703"
FT                   /protein_id="CAH63567.1"
FT                   /translation="MIKLESLQDPSPRKRRTKLLGRGPSSGHGKTSCRGHKGDGSRSGY
FT                   KRRFGYEGGGVPLYRRVPTRGFSHARFDKCVEEITTQRLNALFSEGEEITLEALKQKKA
FT                   IDKRAIRVKVIVKGDLEKTFIWKDANVVLSQGVRNLIGVA"
     MIKLESLQDP SPRKRRTKLL GRGPSSGHGK TSCRGHKGDG SRSGYKRRFG YEGGGVPLYR        60
     RVPTRGFSHA RFDKCVEEIT TQRLNALFSE GEEITLEALK QKKAIDKRAI RVKVIVKGDL       120
     EKTFIWKDAN VVLSQGVRNL IGVA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page