(data stored in SCRATCH zone)

EMBL: CR848038.RPLQ

CR848038.RPLQ        Location/Qualifiers
FT   CDS             120171..120599
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CAB114"
FT                   /product="putative 50s ribosomal protein l17"
FT                   /note="Similar to Chlamydia pneumoniae 50s ribosomal
FT                   protein l17 RplQ or Rl17 or cpn0625 or cp0122
FT                   SWALL:RL17_CHLPN (SWALL:Q9Z7S9) (142 aa) fasta scores: E():
FT                   1.9e-46, 88.02% id in 142 aa, and to Bacillus subtilis 50s
FT                   ribosomal protein l17 RplQ SWALL:RL17_BACSU (SWALL:P20277)
FT                   (119 aa) fasta scores: E(): 1.2e-05, 42.42% id in 132 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB114"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63572"
FT                   /db_xref="GOA:Q5L6Z8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6Z8"
FT                   /protein_id="CAH63572.1"
FT                   /translation="MQHARKKFRVGRTSAHNRCMLANMLKSLIHQERIETTLPKAKELR
FT                   RHADKMITLAKKNTLAARRLAVARLMIRYNKLTSKEARQAKGGDLSVYNVDRKVINKLF
FT                   DELGSRFVSRNGGYTRILKMQNRVGDNARKCIIEFLAN"
     MQHARKKFRV GRTSAHNRCM LANMLKSLIH QERIETTLPK AKELRRHADK MITLAKKNTL        60
     AARRLAVARL MIRYNKLTSK EARQAKGGDL SVYNVDRKVI NKLFDELGSR FVSRNGGYTR       120
     ILKMQNRVGD NARKCIIEFL AN                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page