(data stored in SCRATCH zone)

EMBL: CR848038.RPLW

CR848038.RPLW        Location/Qualifiers
FT   CDS             109701..110036
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CAB095"
FT                   /product="putative 50S ribosomal protein l23"
FT                   /note="Similar to Chlamydia muridarum 50S ribosomal protein
FT                   l23 RplW or tc0813 SWALL:RL23_CHLMU (SWALL:Q9PJL6) (111 aa)
FT                   fasta scores: E(): 1.2e-35, 78.37% id in 111 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB095"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63552"
FT                   /db_xref="GOA:Q5L718"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L718"
FT                   /protein_id="CAH63552.1"
FT                   /translation="MKDPYDVIKRHYVTEKAKTLEGLSLGNGEGKKKGSYCKHPKYTFI
FT                   VDSNATKPLIAQALESIYADKKVKVKSVNTICVKPQPARMFRGKRKGKTAGFKKAVVTF
FT                   YEGHSIG"
     MKDPYDVIKR HYVTEKAKTL EGLSLGNGEG KKKGSYCKHP KYTFIVDSNA TKPLIAQALE        60
     SIYADKKVKV KSVNTICVKP QPARMFRGKR KGKTAGFKKA VVTFYEGHSI G                111
//

If you have problems or comments...

PBIL Back to PBIL home page