(data stored in SCRATCH zone)

EMBL: CR848038.SMPB

CR848038.SMPB        Location/Qualifiers
FT   CDS             498730..499182
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="CAB432"
FT                   /product="ssra-binding protein"
FT                   /note="Similar to Enterococcus faecalis ssra-binding
FT                   (RNA-binding) protein SmpB or ef2616 SWALL:SSRP_ENTFA
FT                   (SWALL:P59630) (154 aa) fasta scores: E(): 3.9e-24, 46.57%
FT                   id in 146 aa, and to Streptococcus pneumoniae ssra-binding
FT                   protein SmpB or sp0976 SWALL:Q97R56 (EMBL:AE007401) (155
FT                   aa) fasta scores: E(): 1.5e-25, 48.61% id in 144 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB432"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63885"
FT                   /db_xref="GOA:Q5L646"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L646"
FT                   /protein_id="CAH63885.1"
FT                   /translation="MASKEIVSNRKALHNYEVLESLEAGIVLTGTEIKSLRDHGGNLGD
FT                   AYVAISKGEAWLLNASIAPYRFGNIYNHEERRKRKLLLHRYEIHKLEVKVAQKGVTIIP
FT                   LGMFLSRGYVKVRLGCCRGKKSHDKRQTIIAREKEREIASAMKRYR"
     MASKEIVSNR KALHNYEVLE SLEAGIVLTG TEIKSLRDHG GNLGDAYVAI SKGEAWLLNA        60
     SIAPYRFGNI YNHEERRKRK LLLHRYEIHK LEVKVAQKGV TIIPLGMFLS RGYVKVRLGC       120
     CRGKKSHDKR QTIIAREKER EIASAMKRYR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page