(data stored in SCRATCH zone)

EMBL: CR848038.THIE

CR848038.THIE        Location/Qualifiers
FT   CDS             215725..216363
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="CAB198"
FT                   /product="putative thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Similar to Bacillus subtilis thiamine-phosphate
FT                   pyrophosphorylase ThiE or ThiC SWALL:THIE_BACSU
FT                   (SWALL:P39594) (222 aa) fasta scores: E(): 1.4e-14, 34.61%
FT                   id in 182 aa, and to Clostridium acetobutylicum
FT                   thiamine-phosphate pyrophosphorylase ThiE SWALL:Q97LQ9
FT                   (EMBL:AE007564) (211 aa) fasta scores: E(): 3e-21, 37.07%
FT                   id in 205 aa. No database matches are to predicted
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB198"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63656"
FT                   /db_xref="GOA:Q5L6R5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6R5"
FT                   /protein_id="CAH63656.1"
FT                   /translation="MEENFFKLILITNKQQISVEEYLDFVCACVQSGVTSVQLREKELS
FT                   YRELLGFGEALKSILDPLEIPLIVSDSVSVCLDLDATGVHLGQTDGDVIEARELLGSDK
FT                   IIGWNVNTLDQLLNANTLPIDYLGLSAMFATQNKPDATNLWGFSGLEQAVSLCEHPIVA
FT                   IGGIDESNASKVIDAGAAGIAAIGVFHSAQNPSSVTKALREIVDRGLRC"
     MEENFFKLIL ITNKQQISVE EYLDFVCACV QSGVTSVQLR EKELSYRELL GFGEALKSIL        60
     DPLEIPLIVS DSVSVCLDLD ATGVHLGQTD GDVIEARELL GSDKIIGWNV NTLDQLLNAN       120
     TLPIDYLGLS AMFATQNKPD ATNLWGFSGL EQAVSLCEHP IVAIGGIDES NASKVIDAGA       180
     AGIAAIGVFH SAQNPSSVTK ALREIVDRGL RC                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page