(data stored in SCRATCH zone)

EMBL: CR848038.TRXA

CR848038.TRXA        Location/Qualifiers
FT   CDS             complement(98179..98487)
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="CAB082"
FT                   /product="putative thioredoxin"
FT                   /note="Similar to Chlamydia psittaci thioredoxin TrxA
FT                   SWALL:THIO_CHLPS (SWALL:P52227) (102 aa) fasta scores: E():
FT                   6.4e-35, 90.19% id in 102 aa, and to Oenococcus oeni
FT                   thioredoxin TrxA SWALL:Q8RKA7 (EMBL:X93091) (104 aa) fasta
FT                   scores: E(): 2.3e-13, 39% id in 100 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB082"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63539"
FT                   /db_xref="GOA:Q5L731"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L731"
FT                   /protein_id="CAH63539.1"
FT                   /translation="MVKVVSAENFNSFIASGLVLIDFFAEWCGPCKMLAPVLESLATEV
FT                   PSVLIGKVNIDDSPAPAEQYGVSSIPTLILFKDGKEVDRTVGLKDKDALIKLINQHA"
     MVKVVSAENF NSFIASGLVL IDFFAEWCGP CKMLAPVLES LATEVPSVLI GKVNIDDSPA        60
     PAEQYGVSSI PTLILFKDGK EVDRTVGLKD KDALIKLINQ HA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page