(data stored in ACNUC7421 zone)

EMBL: CR954246.ACCB

CR954246.ACCB        Location/Qualifiers
FT   CDS             278350..278814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="PSHAa0265"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (BCCP)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12794081, 1370469; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85364"
FT                   /db_xref="GOA:Q3IDT0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT0"
FT                   /protein_id="CAI85364.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEITEGEESVRINRNNMSAGPGYAQ
FT                   FAPQQYAPAPVAAPVAAAPAAAVEAAAPAASTGHQVKSPMVGSFYAAASPEAPAYVEVG
FT                   SQVKVGDTLCIIEAMKMMNQIESDKAGTVKAILAENGEPIEFDQPLFIIE"
     MDIRKIKKLI ELVEESGIAE LEITEGEESV RINRNNMSAG PGYAQFAPQQ YAPAPVAAPV        60
     AAAPAAAVEA AAPAASTGHQ VKSPMVGSFY AAASPEAPAY VEVGSQVKVG DTLCIIEAMK       120
     MMNQIESDKA GTVKAILAEN GEPIEFDQPL FIIE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page