(data stored in ACNUC7421 zone)

EMBL: CR954246.ACCC

CR954246.ACCC        Location/Qualifiers
FT   CDS             278841..280181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PSHAa0266"
FT                   /product="biotin carboxylase (A subunit of acetyl-CoA
FT                   carboxylase)(ACC)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="6.3.4.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1682920, 1370469; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85365"
FT                   /db_xref="GOA:Q3IDS9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS9"
FT                   /protein_id="CAI85365.1"
FT                   /translation="MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETICIGKPAATESYLDIPRIIAAAEITDAVAIHPGYGFLAENADFADQVEQSGFVFIG
FT                   PTGDTIRLMGDKVSAIAAMRKAGVPCVPGSDGPVSDDKERNMQIAKRIGYPVIIKAAGG
FT                   GGGRGMRVVRSEAELIDSIALTQQEAKQFFGNGMVYMEKYLENPRHIEVQILADGQGNA
FT                   VHLGERDCSMQRRHQKVVEEAPAPGITAETRKFIGERCTRACIEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTITEMVTGIDLVKEQLKIAAGQPLSFTQDDVVIRGHAIECRIN
FT                   AEDPETFIPSPGKITRFHPAGGLGIRWDSHIYADYTVPPHYDSMIGKLITYGENRDVAI
FT                   ARARNALNELVIDGIKTNTPLHKRILADENFQNGGTNIHYLEKKLGL"
     MLDKVVIANR GEIALRILRA CKELGIKTVA VHSTADRDLK HVLLADETIC IGKPAATESY        60
     LDIPRIIAAA EITDAVAIHP GYGFLAENAD FADQVEQSGF VFIGPTGDTI RLMGDKVSAI       120
     AAMRKAGVPC VPGSDGPVSD DKERNMQIAK RIGYPVIIKA AGGGGGRGMR VVRSEAELID       180
     SIALTQQEAK QFFGNGMVYM EKYLENPRHI EVQILADGQG NAVHLGERDC SMQRRHQKVV       240
     EEAPAPGITA ETRKFIGERC TRACIEIGYR GAGTFEFLYE NGEFYFIEMN TRIQVEHTIT       300
     EMVTGIDLVK EQLKIAAGQP LSFTQDDVVI RGHAIECRIN AEDPETFIPS PGKITRFHPA       360
     GGLGIRWDSH IYADYTVPPH YDSMIGKLIT YGENRDVAIA RARNALNELV IDGIKTNTPL       420
     HKRILADENF QNGGTNIHYL EKKLGL                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page