(data stored in ACNUC7421 zone)

EMBL: CR954246.ACEE

CR954246.ACEE        Location/Qualifiers
FT   CDS             404449..407115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="PSHAa0391"
FT                   /product="pyruvate dehydrogenase, decarboxylase subunit,
FT                   thiamin-binding"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6343085; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85489"
FT                   /db_xref="GOA:Q3IIH8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH8"
FT                   /protein_id="CAI85489.1"
FT                   /translation="MSEVNKIDVDALETQEWLQALESVVREEGVERAQFLLEQVLEQAR
FT                   LDGVDMPTGITTNYVNTIPVEQEPAYPGDVNIERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSSAAFYEVCFNHFFKAPNDVDGGDLVYYQGHISPGIYARAFVEGRLSASQLD
FT                   NFRQEVGGEGLPSYPHPKLMPEFWQFPTVSMGLGPISSIYQARFLKYLDGRGLKDTKNQ
FT                   RVYAFLGDGEMDEPESRGAISFAAREKLDNLCYLVNCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVIKLVWGSGWDILLAKDKTGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALKRGGHEPSKLFAAFKKAEETKGRPTVILAKTVKGYGMGEA
FT                   AEGKNIAHQVKKMDMSHVAHLRSRLGLDDLISEEQLTELPYLTLEEGTPEHTYLHARRE
FT                   ELKGYTPKRIARFSEKLTVPEVEAFNPLLEEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPHGQNYTPQDRDIVSYYKEATSGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHILASTVPNCISYDPTYAYEVAVIIQDGIRRMYGDDQENIYYYLTLM
FT                   NENYHQPAMPEGAEEGIRKGIYKLESYAGKKANVQLLSSGTIMTEVRKAAKVLSEDYGV
FT                   ASDVFSVTSFNELTRDGQDVERFNMLNPEGEQKTAYITSVLNDSVTVAATDYMKNYAEQ
FT                   ARSFIPSNNYKVLGTDGYGRSDSRENLRRHFEVNADYVVVATLSELAKRGEVEKSVVIE
FT                   ALKKFNIDTNKLNPLYA"
     MSEVNKIDVD ALETQEWLQA LESVVREEGV ERAQFLLEQV LEQARLDGVD MPTGITTNYV        60
     NTIPVEQEPA YPGDVNIERR IRSIIRWNAI MIVLRASKKD LDLGGHMASY QSSAAFYEVC       120
     FNHFFKAPND VDGGDLVYYQ GHISPGIYAR AFVEGRLSAS QLDNFRQEVG GEGLPSYPHP       180
     KLMPEFWQFP TVSMGLGPIS SIYQARFLKY LDGRGLKDTK NQRVYAFLGD GEMDEPESRG       240
     AISFAAREKL DNLCYLVNCN LQRLDGPVMG NGKIIQELEG LFKGAGWNVI KLVWGSGWDI       300
     LLAKDKTGKL LQLMNETVDG DYQTYKAKNG AYVREHFFGR YPETAALVAD MTDDEIFALK       360
     RGGHEPSKLF AAFKKAEETK GRPTVILAKT VKGYGMGEAA EGKNIAHQVK KMDMSHVAHL       420
     RSRLGLDDLI SEEQLTELPY LTLEEGTPEH TYLHARREEL KGYTPKRIAR FSEKLTVPEV       480
     EAFNPLLEEQ KRDISTTMGF VRALNILLKD KGIGKNIVPI IADEARTFGM EGLFRQIGIY       540
     NPHGQNYTPQ DRDIVSYYKE ATSGQVLQEG INELGAMSSW VAAATSYSTN DLPMIPFYIY       600
     YSMFGFQRVG DMAWMAGDQQ ARGFLLGATA GRTTLNGEGL QHEDGHSHIL ASTVPNCISY       660
     DPTYAYEVAV IIQDGIRRMY GDDQENIYYY LTLMNENYHQ PAMPEGAEEG IRKGIYKLES       720
     YAGKKANVQL LSSGTIMTEV RKAAKVLSED YGVASDVFSV TSFNELTRDG QDVERFNMLN       780
     PEGEQKTAYI TSVLNDSVTV AATDYMKNYA EQARSFIPSN NYKVLGTDGY GRSDSRENLR       840
     RHFEVNADYV VVATLSELAK RGEVEKSVVI EALKKFNIDT NKLNPLYA                    888
//

If you have problems or comments...

PBIL Back to PBIL home page