(data stored in ACNUC7421 zone)

EMBL: CR954246.ACEF

CR954246.ACEF        Location/Qualifiers
FT   CDS             407126..409090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="PSHAa0392"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase subunit"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="2.3.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6345153; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85490"
FT                   /db_xref="GOA:Q3IIH7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH7"
FT                   /protein_id="CAI85490.1"
FT                   /translation="MSIEIKVPDIGGDEVEVTEILVAVGDVVEVDQALLTVEGDKASME
FT                   VPADTAGTVKEIKVSVGDNVATGSLVFIFEGESEGESADKSASADKSDSAAEQKTPATD
FT                   AKPAPAASGSTAQDVTLPDIGDDEVEVTEILVAVGDSVSEDQSILSVEGDKASMEVPAP
FT                   FAGTVKEIKVATGDTVKTGSLVFVFEVAGSESAAPAAESTPAETKAAPAAEQSSVSSTK
FT                   EVNVPDIGGDEVEVTEVLVAVGDSVTEDQSLLNVEGDKAAMELPAPFAGTVKEIKVATG
FT                   DKVSTGSLIFVFEVAGGAPAAAAKPEAEKSAPAAKSEKPAPKAETATQSAPAASNESFA
FT                   DNSAYAHASPVVRRLAREFGINLANVKGSGRKNRVVKDDVQNYVKNLVKQVESGQLSAD
FT                   KGNAGGSELGLIPWPKVDFAKFGEIEEKKLSRIQKLSGKNLHRNWVQIPHVTQFDEADI
FT                   TSLEEFRKEQNALNEKKKLGVKITPLVFVMKAAAKALAEFPTINSSLSNDGESLILKKY
FT                   INIGVAVDTPNGLVVPVFKDVDKKGIIELSRELMEVSAKARDGKLTSADMQGGCFTISS
FT                   LGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPKLMVPLSMSYDHRVIDGALA
FT                   ARFTVTLASYMSDIRQLVM"
     MSIEIKVPDI GGDEVEVTEI LVAVGDVVEV DQALLTVEGD KASMEVPADT AGTVKEIKVS        60
     VGDNVATGSL VFIFEGESEG ESADKSASAD KSDSAAEQKT PATDAKPAPA ASGSTAQDVT       120
     LPDIGDDEVE VTEILVAVGD SVSEDQSILS VEGDKASMEV PAPFAGTVKE IKVATGDTVK       180
     TGSLVFVFEV AGSESAAPAA ESTPAETKAA PAAEQSSVSS TKEVNVPDIG GDEVEVTEVL       240
     VAVGDSVTED QSLLNVEGDK AAMELPAPFA GTVKEIKVAT GDKVSTGSLI FVFEVAGGAP       300
     AAAAKPEAEK SAPAAKSEKP APKAETATQS APAASNESFA DNSAYAHASP VVRRLAREFG       360
     INLANVKGSG RKNRVVKDDV QNYVKNLVKQ VESGQLSADK GNAGGSELGL IPWPKVDFAK       420
     FGEIEEKKLS RIQKLSGKNL HRNWVQIPHV TQFDEADITS LEEFRKEQNA LNEKKKLGVK       480
     ITPLVFVMKA AAKALAEFPT INSSLSNDGE SLILKKYINI GVAVDTPNGL VVPVFKDVDK       540
     KGIIELSREL MEVSAKARDG KLTSADMQGG CFTISSLGGI GGTAFTPIVN APEVAILGVS       600
     KSEMKPKWNG KEFEPKLMVP LSMSYDHRVI DGALAARFTV TLASYMSDIR QLVM             654
//

If you have problems or comments...

PBIL Back to PBIL home page