(data stored in ACNUC7421 zone)

EMBL: CR954246.ACNA

CR954246.ACNA        Location/Qualifiers
FT   CDS             complement(167037..169781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="PSHAa0159"
FT                   /product="aconitate hydratase (likely to be used in
FT                   stationary phase); likely to have a 4Fe-4S cluster"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12732309; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85263"
FT                   /db_xref="GOA:Q3IFL7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL7"
FT                   /protein_id="CAI85263.1"
FT                   /translation="MNNSFKTQQQLTVNGEQFHIHSLKGLGDKAKRLPFSLKILLENLL
FT                   RNEDGENIKEQDIQALLDWDPQAKPSAEVAFTPARVVMQDFTGVPAIVDLAAMRDAMEK
FT                   LGGDPAKINPLSPAELVIDHSVQVDGYGNEGAFDLNAKLEYDRNKERYEFLRWGQTAFD
FT                   NLKVVPPATGIVHQVNLEYLARVVFNDERNGQKYAYPDTLVGTDSHTTMINGLGVLGWG
FT                   VGGIEAEAAMLGQPISLLIPQVVGVKLNGRLPEGTTATDLVLTVTEMLRNHGVVGKFVE
FT                   FYGDGLADLPLADRATIANMAPEYGATCGIFPIDDETINYLRLTNRDEKQLKLIEDYAK
FT                   HQGLWRNDGDEANYTDKLELILDDVVPSLAGPKRPQDRISLDKAGEAISQHLKEFQDER
FT                   LAKISSSDTEQARIESEGPVTNPDESSNEAPFIGAAKVNFKGQEFELKDGACVIAAITS
FT                   CTNTSNPSVILAAGLVAKKAKQLGINVKPWVKTSLAPGSKVVTDYLEKAGLMDDLESLG
FT                   FNLVGYGCTTCIGNSGPLAPEISDAIQKHKLVVSSILSGNRNFEGRIHQDVKMNFLASP
FT                   PLVVAYAIAGRTDIDVYNEPLAQDANGNDIYLKNIWPSVKEVSDLVKETVTREMFEKSY
FT                   ANVYEGDSRWQKIQIPDGKLYDWDDASTYIKKAPFFDGMSIEPPGIPTITGARCLAKLG
FT                   DSVTTDHISPAGAIKADSPAGLYLQDNKVGQAQFNSYGSRRGNHEVMMRGTFANIRLKN
FT                   LLAPGTEGGVTRTQPDDELASIYDAAMEYQKNDTPLVILAGKEYGTGSSRDWAAKGSLL
FT                   LGVKAVIAQSYERIHRSNLIGMGVLPLQFKDGESHESLGLTGQEQFDIEGLFDKTKEVS
FT                   VIATNSEGKKVSFSADVRIDTPKEWDYYKHGGILQYVLRNMLD"
     MNNSFKTQQQ LTVNGEQFHI HSLKGLGDKA KRLPFSLKIL LENLLRNEDG ENIKEQDIQA        60
     LLDWDPQAKP SAEVAFTPAR VVMQDFTGVP AIVDLAAMRD AMEKLGGDPA KINPLSPAEL       120
     VIDHSVQVDG YGNEGAFDLN AKLEYDRNKE RYEFLRWGQT AFDNLKVVPP ATGIVHQVNL       180
     EYLARVVFND ERNGQKYAYP DTLVGTDSHT TMINGLGVLG WGVGGIEAEA AMLGQPISLL       240
     IPQVVGVKLN GRLPEGTTAT DLVLTVTEML RNHGVVGKFV EFYGDGLADL PLADRATIAN       300
     MAPEYGATCG IFPIDDETIN YLRLTNRDEK QLKLIEDYAK HQGLWRNDGD EANYTDKLEL       360
     ILDDVVPSLA GPKRPQDRIS LDKAGEAISQ HLKEFQDERL AKISSSDTEQ ARIESEGPVT       420
     NPDESSNEAP FIGAAKVNFK GQEFELKDGA CVIAAITSCT NTSNPSVILA AGLVAKKAKQ       480
     LGINVKPWVK TSLAPGSKVV TDYLEKAGLM DDLESLGFNL VGYGCTTCIG NSGPLAPEIS       540
     DAIQKHKLVV SSILSGNRNF EGRIHQDVKM NFLASPPLVV AYAIAGRTDI DVYNEPLAQD       600
     ANGNDIYLKN IWPSVKEVSD LVKETVTREM FEKSYANVYE GDSRWQKIQI PDGKLYDWDD       660
     ASTYIKKAPF FDGMSIEPPG IPTITGARCL AKLGDSVTTD HISPAGAIKA DSPAGLYLQD       720
     NKVGQAQFNS YGSRRGNHEV MMRGTFANIR LKNLLAPGTE GGVTRTQPDD ELASIYDAAM       780
     EYQKNDTPLV ILAGKEYGTG SSRDWAAKGS LLLGVKAVIA QSYERIHRSN LIGMGVLPLQ       840
     FKDGESHESL GLTGQEQFDI EGLFDKTKEV SVIATNSEGK KVSFSADVRI DTPKEWDYYK       900
     HGGILQYVLR NMLD                                                         914
//

If you have problems or comments...

PBIL Back to PBIL home page