(data stored in ACNUC7421 zone)

EMBL: CR954246.ACNB

CR954246.ACNB        Location/Qualifiers
FT   CDS             193464..196106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="PSHAa0184"
FT                   /product="bifunctional protein [Includes: aconitate
FT                   hydratase 2; 2-methylisocitrate dehydratase] (iron-sulfur
FT                   protein)"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /EC_number="4.2.1.99"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11992126, 12486059; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85287"
FT                   /db_xref="GOA:Q3IJ30"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ30"
FT                   /protein_id="CAI85287.1"
FT                   /translation="MKRYRILSRHQEGNIVLQEYRKHVEERAALGIVPAPLDAQQTADL
FT                   IELIKTPPAGEEEFILDLFANRVPAGVDDAAYIKAGFLAAVAKGETNSPLLSKEKAAEL
FT                   LGTMLGGYNIAPMIDLLDDDTLAPIVVKGLSNTLLMFDAFYDVEEKAKAGNTFAKQIIE
FT                   SWANAEWFTNKPAVAEKISVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKIERD
FT                   GITPDKPGEVGPITQLEELKTKGLPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPN
FT                   KRVGGVCLGNKIAPIFFNTMEDSGALPIELNVDELNMGEQIDIYPYEGVVKQHGTDKVI
FT                   SKFELKSEVILDEVRAGGRIPLIIGRGLTDKARTSLGLGATDIFKVPTATEVSDKGFTL
FT                   AQKMVGKACNVAGIRPGQYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFC
FT                   HTSAYPKPIDVNTHHTLPDFIMNRGGVSLRPGDGIIHSWLNRMLLPDTVGTGGDSHTRF
FT                   PLGISFPAGSGAVAFAAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPYYGIKQG
FT                   LLTVEKKGKINEFSGRVLEIEGVEHLTVEQAFELSDASAERSAAGCTVKLSKESISEYL
FT                   ESNIVMLKWMISEGYGDVRTIERRINAMQDWLANPELMEADKDAEYAHVVEIDLAEIKE
FT                   PVLCAPNDPDDARLLSDVAGEKIDEVFIGSCMTNIGHFRAAGKLLDGFKGQLPTQLWVA
FT                   PPTKMDKDQLIEEGYYGIFGRVGARIETPGCSLCMGNQARVADKATVVSTSTRNFPNRL
FT                   GNGANVFLASSELAAVAAIIGRLPTAAEYQEYAAKINATASDTYRYLNFHRMPAYTKKA
FT                   DNVIIQQAV"
     MKRYRILSRH QEGNIVLQEY RKHVEERAAL GIVPAPLDAQ QTADLIELIK TPPAGEEEFI        60
     LDLFANRVPA GVDDAAYIKA GFLAAVAKGE TNSPLLSKEK AAELLGTMLG GYNIAPMIDL       120
     LDDDTLAPIV VKGLSNTLLM FDAFYDVEEK AKAGNTFAKQ IIESWANAEW FTNKPAVAEK       180
     ISVTVFKVTG ETNTDDLSPA PDAWSRPDIP LHALAMLKIE RDGITPDKPG EVGPITQLEE       240
     LKTKGLPLAY VGDVVGTGSS RKSATNSVLW FMGDDIPFVP NKRVGGVCLG NKIAPIFFNT       300
     MEDSGALPIE LNVDELNMGE QIDIYPYEGV VKQHGTDKVI SKFELKSEVI LDEVRAGGRI       360
     PLIIGRGLTD KARTSLGLGA TDIFKVPTAT EVSDKGFTLA QKMVGKACNV AGIRPGQYCE       420
     PKMTTVGSQD TTGPMTRDEL KDLACLGFSA DLTMQSFCHT SAYPKPIDVN THHTLPDFIM       480
     NRGGVSLRPG DGIIHSWLNR MLLPDTVGTG GDSHTRFPLG ISFPAGSGAV AFAAATGVMP       540
     LDMPESILVR FKGEMQPGIT LRDLVHAIPY YGIKQGLLTV EKKGKINEFS GRVLEIEGVE       600
     HLTVEQAFEL SDASAERSAA GCTVKLSKES ISEYLESNIV MLKWMISEGY GDVRTIERRI       660
     NAMQDWLANP ELMEADKDAE YAHVVEIDLA EIKEPVLCAP NDPDDARLLS DVAGEKIDEV       720
     FIGSCMTNIG HFRAAGKLLD GFKGQLPTQL WVAPPTKMDK DQLIEEGYYG IFGRVGARIE       780
     TPGCSLCMGN QARVADKATV VSTSTRNFPN RLGNGANVFL ASSELAAVAA IIGRLPTAAE       840
     YQEYAAKINA TASDTYRYLN FHRMPAYTKK ADNVIIQQAV                             880
//

If you have problems or comments...

PBIL Back to PBIL home page