(data stored in ACNUC7421 zone)

EMBL: CR954246.ADD

CR954246.ADD         Location/Qualifiers
FT   CDS             106040..107041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PSHAa0102"
FT                   /product="adenosine deaminase"
FT                   /function="2.3.1.4 : Salvage of nucleosides and
FT                   nucleotides"
FT                   /EC_number="3.5.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11330670, 11440125; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85211"
FT                   /db_xref="GOA:Q3IF68"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF68"
FT                   /protein_id="CAI85211.1"
FT                   /translation="MINRKLPLLDIHRHLDGNVRAQTILELGRQFNITLPADNVAALIP
FT                   HVQVIDPEPNLMAFLQKLDWGVTVLGDYDACRRIAIENIEDAQAQGLDYVELRFSPYYM
FT                   AQSQGLHPQGVVEAVIDGIKSATKGANVKANLIGILSRTYGVKVCQQELDALLAFKDDL
FT                   VAVDLAGDEIGFPGELFVEHFKQVHDAYLAATIHAGEALGAPSIWQAINELGASRIGHG
FT                   VKAIEDIELMNYLRDKRIGIESCLTSNIQTSTVNDLAQHPLKQFLDHGILACINTDDPA
FT                   VEGIEIEHEYLVAAPQAGLSQADIEKAQANALEIAYLSYSDKKALLTMASTR"
     MINRKLPLLD IHRHLDGNVR AQTILELGRQ FNITLPADNV AALIPHVQVI DPEPNLMAFL        60
     QKLDWGVTVL GDYDACRRIA IENIEDAQAQ GLDYVELRFS PYYMAQSQGL HPQGVVEAVI       120
     DGIKSATKGA NVKANLIGIL SRTYGVKVCQ QELDALLAFK DDLVAVDLAG DEIGFPGELF       180
     VEHFKQVHDA YLAATIHAGE ALGAPSIWQA INELGASRIG HGVKAIEDIE LMNYLRDKRI       240
     GIESCLTSNI QTSTVNDLAQ HPLKQFLDHG ILACINTDDP AVEGIEIEHE YLVAAPQAGL       300
     SQADIEKAQA NALEIAYLSY SDKKALLTMA STR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page