(data stored in ACNUC7421 zone)

EMBL: CR954246.ALAS

CR954246.ALAS        Location/Qualifiers
FT   CDS             546824..549430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="PSHAa0532"
FT                   /product="alanyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9153306, 12588865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85621"
FT                   /db_xref="GOA:Q3ILF3"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILF3"
FT                   /protein_id="CAI85621.1"
FT                   /translation="MQHMTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGM
FT                   VQFKDVFLGAESRPYTRATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYF
FT                   KQDAIKFAWQFLTEEVKLPKEKLLVTIYHDDEEAFNYWSNDIGLPADRIIRIATADNFW
FT                   SMGDTGPCGPCSEIFYDHGEHIWGGPPGSPEEDGDRFIEIWNLVFMQYNRQNDGTMLPL
FT                   PKQSVDTGMGLERIAAILQGVHSNYEIDLFKGLIAAAASVTNAQDMDDKSLRVVADHIR
FT                   SCAFLISDGVMPSNEGRGYVLRRIIRRAVRHGNKLGAQGAFFYKLVAALIEQMGQAYPE
FT                   LAKQQEIIEKVLRIEEEQFGKTLERGLAILEESLSDLKGDVIPGDLVFKLYDTYGFPAD
FT                   LTADVARERQMTIDNKGFEECMAVQRKTAQQAGKFGADYNDQLKSDKQTTYKGYTTTSH
FT                   SATVVEVFAGSESVSLLEDGQKGIVILDRTPFYAESGGQVGDTGVISVAGGEFTVTNTT
FT                   KLGNAFAHHGIVQGRIGLNDKVEATIDDARRERIKKNHTATHILHETLRQLLGEHVGQK
FT                   GSLVQAERLRFDFSHFEAVTKEELREIERVVNDEIRCNFALSTELMAIDDAKAKGAMAL
FT                   FGEKYDDEVRVVTIGDYSIELCGGTHVERAGDIGLFKIVSESGIAAGVRRIEAVTGADA
FT                   IAYVSEQEQKLNDVAAVVKADSASVLEKVTALLDKSKQLEKQIAQLNDKLASAAGASLL
FT                   DSVVEINGIKLLIANVKGTESKALRGMVDDLKNKIGSGVIALGVASDDKVSLIAGVTKD
FT                   LTGRVKAGELVNHMASQVGGKGGGRPDMAQAGGSEPENLTAALDSVTAWFTEKTQA"
     MQHMTTAQIR QQFLDFFASK QHQVVPSSSL IPGNDATLLF NNAGMVQFKD VFLGAESRPY        60
     TRATSSQRCV RAGGKHNDLE NVGYTARHHT FFEMLGNFSF GDYFKQDAIK FAWQFLTEEV       120
     KLPKEKLLVT IYHDDEEAFN YWSNDIGLPA DRIIRIATAD NFWSMGDTGP CGPCSEIFYD       180
     HGEHIWGGPP GSPEEDGDRF IEIWNLVFMQ YNRQNDGTML PLPKQSVDTG MGLERIAAIL       240
     QGVHSNYEID LFKGLIAAAA SVTNAQDMDD KSLRVVADHI RSCAFLISDG VMPSNEGRGY       300
     VLRRIIRRAV RHGNKLGAQG AFFYKLVAAL IEQMGQAYPE LAKQQEIIEK VLRIEEEQFG       360
     KTLERGLAIL EESLSDLKGD VIPGDLVFKL YDTYGFPADL TADVARERQM TIDNKGFEEC       420
     MAVQRKTAQQ AGKFGADYND QLKSDKQTTY KGYTTTSHSA TVVEVFAGSE SVSLLEDGQK       480
     GIVILDRTPF YAESGGQVGD TGVISVAGGE FTVTNTTKLG NAFAHHGIVQ GRIGLNDKVE       540
     ATIDDARRER IKKNHTATHI LHETLRQLLG EHVGQKGSLV QAERLRFDFS HFEAVTKEEL       600
     REIERVVNDE IRCNFALSTE LMAIDDAKAK GAMALFGEKY DDEVRVVTIG DYSIELCGGT       660
     HVERAGDIGL FKIVSESGIA AGVRRIEAVT GADAIAYVSE QEQKLNDVAA VVKADSASVL       720
     EKVTALLDKS KQLEKQIAQL NDKLASAAGA SLLDSVVEIN GIKLLIANVK GTESKALRGM       780
     VDDLKNKIGS GVIALGVASD DKVSLIAGVT KDLTGRVKAG ELVNHMASQV GGKGGGRPDM       840
     AQAGGSEPEN LTAALDSVTA WFTEKTQA                                          868
//

If you have problems or comments...

PBIL Back to PBIL home page