(data stored in ACNUC7421 zone)

EMBL: CR954246.AMIB

CR954246.AMIB        Location/Qualifiers
FT   CDS             280889..282184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="PSHAa0268"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II, murein
FT                   hydrolase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="3.5.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8824618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85367"
FT                   /db_xref="GOA:Q3IDT8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT8"
FT                   /protein_id="CAI85367.1"
FT                   /translation="MSSSLWAQNTINSVRVWPSPDSTRVVFDLTEKPDFSYFMLKNPSR
FT                   LVVDLEQTRELKVLPGIPPEHQIVSKLRYSKPKNKHSVRFVFELSAPVKPVVFALAPTG
FT                   PYKNRLVVDLYDKSESSTAVSPAQTAAKNRQLSQERDIVIAIDAGHGGEDPGSIGPSGT
FT                   YEKTITLQIAKRLERMIDSERGMISRMVRSGDYFVKLNTRTNRAREKKADFFVSIHADA
FT                   FTSPGPNGASVWVLSLRRANSEIGKWIEDKEKHSELLGGAADVIKDAANEKYLAQALLD
FT                   MSMDHSMKTGLSVADEVVKELRKVAKLHKKDPQHASLAVLKSPDIPSILIETGFISNPR
FT                   EEKLLKSANHQERLAKAIFTSIKNYYLKNPPDDSLFAKLKSQYPTKHKVRPGESLSMLA
FT                   SRYGITINKLKQANKLSSNTLFIGQELDIPQS"
     MSSSLWAQNT INSVRVWPSP DSTRVVFDLT EKPDFSYFML KNPSRLVVDL EQTRELKVLP        60
     GIPPEHQIVS KLRYSKPKNK HSVRFVFELS APVKPVVFAL APTGPYKNRL VVDLYDKSES       120
     STAVSPAQTA AKNRQLSQER DIVIAIDAGH GGEDPGSIGP SGTYEKTITL QIAKRLERMI       180
     DSERGMISRM VRSGDYFVKL NTRTNRAREK KADFFVSIHA DAFTSPGPNG ASVWVLSLRR       240
     ANSEIGKWIE DKEKHSELLG GAADVIKDAA NEKYLAQALL DMSMDHSMKT GLSVADEVVK       300
     ELRKVAKLHK KDPQHASLAV LKSPDIPSIL IETGFISNPR EEKLLKSANH QERLAKAIFT       360
     SIKNYYLKNP PDDSLFAKLK SQYPTKHKVR PGESLSMLAS RYGITINKLK QANKLSSNTL       420
     FIGQELDIPQ S                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page