(data stored in ACNUC7421 zone)

EMBL: CR954246.AMPD

CR954246.AMPD        Location/Qualifiers
FT   CDS             401490..402044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="PSHAa0388"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85486"
FT                   /db_xref="GOA:Q3III1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III1"
FT                   /protein_id="CAI85486.1"
FT                   /translation="MNIDLNGVVNCALQRGCSHFDERPSDTDVSLLVIHNISLPAGQFG
FT                   TPYVDDLFMGTLNCEAHSSFSDLHGVRVSAHCFIKRSGELVQYVPFTKRAWHAGASEFN
FT                   GQTNCNNFSIGIELEGTDTTAYTLAQYTSLKILSEAIMQRYPNITTERIVGHCDIAPGR
FT                   KTDPGSSFNWHLFLTMLKQSG"
     MNIDLNGVVN CALQRGCSHF DERPSDTDVS LLVIHNISLP AGQFGTPYVD DLFMGTLNCE        60
     AHSSFSDLHG VRVSAHCFIK RSGELVQYVP FTKRAWHAGA SEFNGQTNCN NFSIGIELEG       120
     TDTTAYTLAQ YTSLKILSEA IMQRYPNITT ERIVGHCDIA PGRKTDPGSS FNWHLFLTML       180
     KQSG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page