(data stored in ACNUC7421 zone)

EMBL: CR954246.AMPH

CR954246.AMPH        Location/Qualifiers
FT   CDS             346985..348526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="PSHAa0335"
FT                   /product="putative beta-lactamase, penicillin-binding
FT                   protein"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.1 : Cell wall"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9324260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85434"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF02"
FT                   /protein_id="CAI85434.1"
FT                   /translation="MKLIKFATIALLAGATFSTWAQVDTNKIEQVIKTSMARFDVPGMA
FT                   VAIVENDKVIFAKGFGVTHINTGNKVNKDTLFGIASNTKAFTSAALAKLVDEGKLSWDD
FT                   KVIDHLPEFQLYDAYVTREMRIRDLLSHRSGLGLGQGDLMIWPSTDKSVDDILAGLKYL
FT                   KPASSFRSQYAYNNLMFVTAGEVVARVSGMSWNDYIEKNMLQPLNMTHSRAGFSRIPSS
FT                   NKNWATGHIPMDNQLHPFFVNYLEDFRGAGAIASSASDMSQWLRTQLAGGTMPNGEQLF
FT                   SEKQQAQMWHPHITAMASKSAFEAYHQQFRGYGLGWSIEDYHGFKKLGHNGGILGMVSQ
FT                   VTLLPEKKLGIVILSNQQALGALAAVTHEVLEDALELEDKDWVEDLAKKHFESKEKAYG
FT                   NAKPAAPADYQPQLPNINYTGTLHDNWYGDVIIEQLDGKLHIDFTHTKGLKGSLEHYTG
FT                   NTFIVKWDEKLLEADAFINFNMNTENRVSSAKMRAVSTQVTDFSFDFRNLKLTAK"
     MKLIKFATIA LLAGATFSTW AQVDTNKIEQ VIKTSMARFD VPGMAVAIVE NDKVIFAKGF        60
     GVTHINTGNK VNKDTLFGIA SNTKAFTSAA LAKLVDEGKL SWDDKVIDHL PEFQLYDAYV       120
     TREMRIRDLL SHRSGLGLGQ GDLMIWPSTD KSVDDILAGL KYLKPASSFR SQYAYNNLMF       180
     VTAGEVVARV SGMSWNDYIE KNMLQPLNMT HSRAGFSRIP SSNKNWATGH IPMDNQLHPF       240
     FVNYLEDFRG AGAIASSASD MSQWLRTQLA GGTMPNGEQL FSEKQQAQMW HPHITAMASK       300
     SAFEAYHQQF RGYGLGWSIE DYHGFKKLGH NGGILGMVSQ VTLLPEKKLG IVILSNQQAL       360
     GALAAVTHEV LEDALELEDK DWVEDLAKKH FESKEKAYGN AKPAAPADYQ PQLPNINYTG       420
     TLHDNWYGDV IIEQLDGKLH IDFTHTKGLK GSLEHYTGNT FIVKWDEKLL EADAFINFNM       480
     NTENRVSSAK MRAVSTQVTD FSFDFRNLKL TAK                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page