(data stored in ACNUC7421 zone)

EMBL: CR954246.ARCA

CR954246.ARCA        Location/Qualifiers
FT   CDS             complement(566343..567059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="PSHAa0551"
FT                   /product="aerobic respiration control protein arcA (Dye
FT                   resistance protein)"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2984198, 7565118; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85639"
FT                   /db_xref="GOA:Q3ILJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ3"
FT                   /protein_id="CAI85639.1"
FT                   /translation="MQTPVILIVEDEDVTRLNLVSLFEAEGYKVIEAIDGDDMHDKLTN
FT                   NDDVNLVVMDINLPGKNGLILARELRQKRKVGLIFLTGRDNDVDRILGLEIGADDYITK
FT                   PFNPRELTIRARNLITRTALGGEESALETNGVITFNGWELDENSRCLTSPGGDAKRLPK
FT                   GEYRALRLMLDSPGRIFSREQLIKHMTGRELRANDRTVDVTIRRIRKHFESDNSTTELI
FT                   STIHGEGYRFIGKIDS"
     MQTPVILIVE DEDVTRLNLV SLFEAEGYKV IEAIDGDDMH DKLTNNDDVN LVVMDINLPG        60
     KNGLILAREL RQKRKVGLIF LTGRDNDVDR ILGLEIGADD YITKPFNPRE LTIRARNLIT       120
     RTALGGEESA LETNGVITFN GWELDENSRC LTSPGGDAKR LPKGEYRALR LMLDSPGRIF       180
     SREQLIKHMT GRELRANDRT VDVTIRRIRK HFESDNSTTE LISTIHGEGY RFIGKIDS         238
//

If you have problems or comments...

PBIL Back to PBIL home page