(data stored in ACNUC7421 zone)

EMBL: CR954246.ARCB

CR954246.ARCB        Location/Qualifiers
FT   CDS             564020..566338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="PSHAa0550"
FT                   /product="aerobic respiration control sensor protein arcB"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85638"
FT                   /db_xref="GOA:Q3ILJ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ4"
FT                   /protein_id="CAI85638.1"
FT                   /translation="MTDSSLSPWARVLSSLITRFGEFKTAAICYALLLAVSLVLSSMFY
FT                   YVAVGEVNLVDILAVVFFTSVVSPLVISVLINSIRQLDASYAYLDSATKQEKLLNQTLK
FT                   DNINRLNVEIDERKMAFHAKHRAIEELRKEIAERKKTQQELAQQSMLQRSIVDSSPDLF
FT                   YYRDNNGVFAGCNKMFEEVMGKTSDELIGKSAEQIFPNQFLSEVLKTDKQVEQTHQALT
FT                   IDVQYDVGGETRWFELRKLPFINDKGKYIGLLAFGRDITSRKEAAEALETAYKDKGKFI
FT                   ATLSHELRTPLNGIVGLTRMLLDTELNKQQRSWCNTVFSSAETLGNIFNDIIDLDKIDR
FT                   EQLDIATNAINVSDFINDVVNFAGLIAEQKDLSFDIKRLGMLDIYAQLDPTRLRQVVWN
FT                   LINNAVKFTHKGSVTLTCIRENRDDGPWLTMKISDTGEGIPAEQLSRIFDMYYKAPDLK
FT                   GTNAIGSGIGLAVTKALVDAMQGIISVNSTEGEGSCFIVEIPLILCSAPTENSYVGRSL
FT                   NILLVEDVPLNAEIATNLLEQRGHEVIWAETGEDALSFVETEDDLDLILLDMQLPDING
FT                   DEVARQIRADSHFDKLPIVALTANVRSAEQELEGISIQGALAKPINTVKLDKILADLFG
FT                   IKQTRSNEPQLKVSTAALADINAHLLDVETIEDFVNSMGLVVFKRSSQLFEKLNPQYQQ
FT                   ELLTSLNSGDREEYKSVAHKLKGAAGSVGLNDVQLHAKVMEYGALDKSDEVLKQWLDVL
FT                   ADKINEGQHALHLFLQQLE"
     MTDSSLSPWA RVLSSLITRF GEFKTAAICY ALLLAVSLVL SSMFYYVAVG EVNLVDILAV        60
     VFFTSVVSPL VISVLINSIR QLDASYAYLD SATKQEKLLN QTLKDNINRL NVEIDERKMA       120
     FHAKHRAIEE LRKEIAERKK TQQELAQQSM LQRSIVDSSP DLFYYRDNNG VFAGCNKMFE       180
     EVMGKTSDEL IGKSAEQIFP NQFLSEVLKT DKQVEQTHQA LTIDVQYDVG GETRWFELRK       240
     LPFINDKGKY IGLLAFGRDI TSRKEAAEAL ETAYKDKGKF IATLSHELRT PLNGIVGLTR       300
     MLLDTELNKQ QRSWCNTVFS SAETLGNIFN DIIDLDKIDR EQLDIATNAI NVSDFINDVV       360
     NFAGLIAEQK DLSFDIKRLG MLDIYAQLDP TRLRQVVWNL INNAVKFTHK GSVTLTCIRE       420
     NRDDGPWLTM KISDTGEGIP AEQLSRIFDM YYKAPDLKGT NAIGSGIGLA VTKALVDAMQ       480
     GIISVNSTEG EGSCFIVEIP LILCSAPTEN SYVGRSLNIL LVEDVPLNAE IATNLLEQRG       540
     HEVIWAETGE DALSFVETED DLDLILLDMQ LPDINGDEVA RQIRADSHFD KLPIVALTAN       600
     VRSAEQELEG ISIQGALAKP INTVKLDKIL ADLFGIKQTR SNEPQLKVST AALADINAHL       660
     LDVETIEDFV NSMGLVVFKR SSQLFEKLNP QYQQELLTSL NSGDREEYKS VAHKLKGAAG       720
     SVGLNDVQLH AKVMEYGALD KSDEVLKQWL DVLADKINEG QHALHLFLQQ LE               772
//

If you have problems or comments...

PBIL Back to PBIL home page